KEGG   Edwardsiella tarda EIB202: ETAE_1651Help
Entry
ETAE_1651         CDS       T01121                                 

Definition
(GenBank) integral membrane protein, PqiA family
  KO
K03808  paraquat-inducible protein A
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ETAE_1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PqiA zinc-ribbons_6
Motif
Other DBs
NCBI-ProteinID: ACY84492
UniProt: D0Z7S3
Position
complement(1755110..1756354)
Genome map
AA seq 414 aa AA seqDB search
MTRRVGVPTHRLRCPECDALCRLPTIDARQSAFCPRCDARLYDGRDWPLPRLAALSLTLL
VLLPLALFQPLLQIHLLGVTVQASVWQGIGQMAMQGEILTAGMVAFCAIVAPLLLPSLLL
ALYLGQRLRLNLRPLLLLLTLLRPWIMLDIYLIALAVAAIKVREYAAVDPGPALLAYIVA
TLLTLLLLIHLNLEQLWRRLYPQPPQTAPDSALLLCHACRHTAPPDAHGHCRRCRLPLHR
RQPYSLQKTWATLIAAVIILLPANLQPISILYVNGVRIEDTLLSGTLALANGGNLPIAAI
VFIASILVPFIKVAVMLFLLLGIHLRRGGDLVRRMRMLRLVTWIGRWSMLDLFVIALMMS
LIDRDQLFSFTMGAAAFYFGAAVFLTLLAVEWLDSRLIWDAHATTDANDTKYAQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactcgccgagtcggcgtcccgacgcatcgtctgcgctgcccggagtgcgatgcgctg
tgccgtctcccgaccatcgacgcacgccagtccgccttttgtccgcgctgcgacgcccgc
ctgtatgatggccgagactggccgctgccccgcctcgcggcgctatcgctcaccctgctg
gtactcttgccgctggccctgtttcagccgctgctacagatccatctgctgggcgtcacg
gtgcaggccagcgtctggcagggcatcggacagatggccatgcagggcgagatcctcacc
gctggcatggtcgccttctgcgccatcgtagcgccgctgctgctgccctcgctgctgctg
gcgctgtacctcggccagcgactgcgcctgaacctgcgcccgctgctgctgctgctcacc
ctgctgcgcccgtggatcatgctggatatctacctgatcgcgctggccgtcgccgccatt
aaggtccgcgaatatgccgccgtcgatcccggtcccgcgctgctggcctatatcgtcgcc
accctgctgaccctgctgctgctgatccatctgaacctcgaacagctgtggcgccgcctg
tacccgcagccgccccaaacggcgccggacagcgcgctgctgctatgccacgcctgtcgc
catacggccccgccggacgcccacggacactgccgacgctgccgcctaccgctgcaccgc
cgtcagccctacagcctgcaaaaaacctgggccaccctgatcgccgccgtgatcatcctg
ctgccggccaacctgcagcccatctcgatcctgtacgtcaacggcgtgcgcatcgaggac
accctgctctcgggaacgctcgccttggccaacggggggaatctgccgatcgccgcgatc
gtctttatcgccagcatcctggtgccctttatcaaggtggcggtcatgctgttcctgctg
ctgggcatacacctgcgccgcgggggcgacctggtgcggcgcatgcgcatgctgcggctg
gtcacctggatcggtcgctggtcgatgctggacctgtttgtcattgcgctgatgatgtcg
ctaatcgatcgcgaccagctgttctcgtttaccatgggcgcggcggccttttatttcggc
gccgcggtatttctgacgctgctggccgtggaatggctggacagtcgactgatatgggat
gcacatgccacaaccgacgccaacgacacaaaatacgcccaataa

DBGET integrated database retrieval system