KEGG   Edwardsiella tarda EIB202: ETAE_1653Help
Entry
ETAE_1653         CDS       T01121                                 

Gene name
proQ
Definition
(GenBank) putative solute/DNA competence effector
  KO
K03607  ProP effector
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    ETAE_1653 (proQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ProQ ProQ_C DUF4407
Motif
Other DBs
NCBI-ProteinID: ACY84494
UniProt: D0Z7S5
Position
1757174..1757878
Genome map
AA seq 234 aa AA seqDB search
MENQPKLNSSKEVIAFLAQRFPQCFSTEGEARPLKIGIFQDLVARMQGEENGLSKTQLRS
ALRLYTSSWRYLHGVKLGAERVDLDGNACGVLDEQHVEHARQQLEEAKARVQAQRDARKR
EAAENGEKREPRRPRPAGKKPTVRRDAEQGSKEVRKPRAAKATQERKPRAKSETTEQRST
PVTSLEQLHLGQTVKVSAGKHAMEASVLEITKDGVRVQLSNGLAMIVRTEHLQF
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaccaaagttgaacagtagtaaagaagtcatcgcctttttggctcaacgt
ttccctcagtgcttcagcaccgagggtgaagcccgcccgttaaagatcggcatctttcag
gatctggttgcgcggatgcagggggaagaaaacggcctgagcaagactcagctacgttca
gcactccgcctttacacatccagctggcgctacctgcacggggtaaaactgggtgcagag
cgtgtcgatctggatggcaacgcctgcggcgtgctggacgagcagcacgtagagcatgcc
cgtcagcagctggaagaggccaaggcccgggtccaggcacagcgtgacgcccgcaagcgc
gaagccgccgaaaacggcgaaaagcgcgagccgcgccgtccgcgtccggcgggtaaaaag
cccaccgtgcgccgtgacgctgagcagggcagtaaagaagtgcgtaaaccgcgtgccgcc
aaggctacgcaggagcgcaaaccgcgcgccaagagcgagaccacggaacagcgcagcacc
ccggtgacctcgctggagcagctgcacctggggcaaaccgtgaaggtcagcgccggtaag
catgccatggaggcatccgtactcgagatcaccaaagacggtgtacgtgtccagctgtct
aacggtctggcaatgattgtacgcacagaacacttgcagttctga

DBGET integrated database retrieval system