KEGG   Edwardsiella tarda EIB202: ETAE_1658Help
Entry
ETAE_1658         CDS       T01121                                 

Gene name
putA
Definition
(GenBank) multifunctional: proline dehydrogenase (in membrane);pyrroline-5-carboxylate dehydrogenase (in membrane); transcriptional repressor of proline synthesis (in cytoplasm)
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00250  Alanine, aspartate and glutamate metabolism
etr00330  Arginine and proline metabolism
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAE_1658 (putA)
   00330 Arginine and proline metabolism
    ETAE_1658 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etr03000]
    ETAE_1658 (putA)
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     ETAE_1658 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     ETAE_1658 (putA)
Transcription factors [BR:etr03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    ETAE_1658 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg
Motif
Other DBs
NCBI-ProteinID: ACY84499
UniProt: D0Z7T0
Position
complement(1763264..1767193)
Genome map
AA seq 1309 aa AA seqDB search
MATTTLGVKLDDAARERIKAAASQIDRTPHWLIKQAIFSYLERLEQGETLPELATAVDPP
ALETAPPPQEGHSPFLAFAEQILPQSVLRANITAAYRRAESDAVPMLLEQARLPPPLAEQ
AYQLAYRLAKQLRGQKNAGGRAGMVQSLLQEFSLSSQEGVALMCLAEALLRIPDKATRDA
LIRDKISGGDWQSHLGHSPSLFVNAATWGLLFTGRLVATHSEAHLSHALSRIIGKRGEPL
IRKGVDMAMRLMGEQFVTGETISEALANAHRLEEKGFRYSYDMLGEAALTAADAQAYLLS
YQQAIHAIGKAANGRGIYEGPGISIKLSALHPRYSRAQYERVMEELYPTLRALTLLARQY
DIGINIDAEEADRLELSLDLLERLCHEPELSGWNGIGFVIQAYQKRCPAVIDYLIDLAAR
SQRRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVAYLACAKKLLSVPRLIYPQ
FATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYQQVVGKVADGKLNRPCRIYAPV
GTHETLLAYLVRRLLENGANTSFVNRIADASLPLEDLVADPVAAVDKLTAQEGCPGLPHP
KIPLPRDLYAPGRANAAGLDLSNEQRLASLSCALLNDTHQRWVATPLLEQPCAEDELRPL
PNPAESGDIVGYTRDASEQEVAQALANAQRNAPIWGATPPQARAAILARAATLMERQMPT
LVGILIREAGKTFANAIAEVREAVDFLRYYAEQVHASFDNETHRPLGCVVCISPWNFPLA
IFTGQIAAALAAGNSVLAKPAEQTPLIAAQAIALLHCAGVPPGAVQLLPGRGETVGAQLV
NDSRVRGVMFTGSTEVAKRLQRAVADRLDAQGRPTPLIAETGGLNAMIVDSSALTEQVVG
DIVTSAFDSAGQRCSALRLLCLQEEIAERTLTMLRGAMAEYRLGNPERLACDIGPVIDSE
AQSNIEQHILAMRAKGHPVFQAACAQDDLQRNARGNFVPPTLIELDSLNTLQREIFGPVL
HVVRYRREQLDALLAQINDAGYGLTLGVHSRIDETIDRIAERAHVGNIYVNRNIVGAVVG
VQPFGGEGLSGTGPKAGGPLYLYRLLARSPENALTFGADAAHRQPDSAASPLQALNDWAA
DRPALQILCQRYASLYPGAAPRLLGGPTGERNTLRLVPRERVLCVAEREDDALIQLAAAL
AVGCRVLWPETPLHRALHKDLPPAVAARITLSPAETLMAQAFDAAIYHGDSDRLRLLGAQ
IAARDGAIVTLQGLAPGDTRLRLALLVHERALSVNTAAAGGNASLMTLS
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgacaaccctgggcgttaagcttgatgacgccgcccgcgagcgcatcaaggcg
gccgccagccagattgaccgtacgccgcactggctgatcaaacaggccatcttcagctac
ctggagcgtctggaacagggcgaaacgctgccggagctggcgaccgccgtcgatcccccc
gcgttagagacggcgccaccgccgcaggagggacactcacccttcctagcgttcgccgaa
caaattctgccgcagtcggtgctgcgggccaatatcaccgcggcctaccgccgtgcggag
agcgacgccgtcccgatgctgctcgaacaggcccgcctgccgccccccctggccgagcag
gcatatcagctggcctaccgcctggcgaagcagctgcgcggccagaagaacgccggcgga
cgggccggcatggtacagagcctgctgcaggagttctccctctcctcgcaggagggggtc
gcgctgatgtgcctggccgaggcgctgctgcgcattcccgataaggccacccgcgatgcg
ctgatccgcgacaagatcagcggcggagactggcagtcgcatctcggtcacagcccctcg
ctgttcgtcaacgccgccacctgggggctgctgttcaccggccggctggtcgcgacccac
agcgaggcccacctctcccacgcgctgagccggatcatcggcaagcgcggcgagcccctg
atccgtaagggggtggatatggcgatgcgcctgatgggggagcagttcgtcaccggcgag
accatctctgaggcgctggccaacgcgcatcgcctggaggagaaaggcttccgctactcc
tacgacatgctgggcgaggcggcgctgaccgccgccgacgcgcaggcctatctgctctcc
taccagcaggcgatccacgccatcggcaaggcggccaacgggcgcggcatctatgaagga
ccggggatctcgatcaagctctccgccctgcacccgcgctatagccgcgcccagtatgaa
cgcgtgatggaggagctgtatccgacccttcgcgccctcaccctgctggcgcgccagtac
gacatcggcatcaatatcgacgccgaggaggccgaccgcctggagctctctctcgatctg
ctggagaggctgtgccatgagcccgagctgagcggctggaacggcatcggctttgtgatc
caggcctaccaaaagcgttgccccgcggtgatcgactacctgatcgatctcgccgcccgc
agccagcgccgtctgatgatccgcctggtgaagggggcctactgggacagcgagatcaag
cgcgcccaggtcgaagggctggaggggtatccggtctacacccgcaaggtctataccgac
gtcgcctacctggcctgcgccaagaagctgttgagcgtgcctcgcctgatctacccgcag
ttcgccacccataacgcccatacgctggcggccatctatcaattggccggacagaactac
tacccggggcagtatgagttccagtgcctgcacggcatgggcgagccgctataccagcag
gtggtcggcaaggtcgccgacggcaaactcaatcgcccctgccgcatctatgcgccggtc
ggcacccatgagacgctgctggcctatctggtgcgccgtctgctggagaatggcgccaac
acctccttcgtcaatcgcatcgccgatgccagcctgccgctggaggatctggtcgccgac
ccggtcgccgccgtggataagctgacggcgcaggagggatgccccggactcccccatcca
aagatcccgctgccgcgcgatctgtatgccccggggcgcgccaacgccgccggactggat
ctgagcaatgagcagcgcctggcctctctctcctgcgctctgctgaacgacacccatcag
cggtgggtagccacgccgctgctggagcagccctgcgccgaagacgagctgcgccccctg
cctaaccccgccgagtcgggcgatatcgtcggctatacgcgcgacgccagcgagcaggaa
gtcgcgcaggcgttggcgaacgcgcagcgtaacgcccccatctggggggccacgccgccg
caggcccgtgccgccatcctggcgcgcgccgccaccctgatggagcgccagatgccgacg
ctggtggggattctgatacgcgaggcgggcaagaccttcgccaacgccatcgccgaggtg
cgcgaagccgtcgacttcctgcgctactatgccgaacaggtgcacgccagcttcgacaac
gagacccatcgcccgctgggctgcgtcgtctgtatcagcccgtggaacttcccgctggcc
atctttaccggccagatcgccgccgcgctggccgccggcaacagcgtactggccaagccc
gccgaacagacgccgctgatcgccgcccaggctatcgccctgctgcactgcgccggcgtc
ccacccggcgccgtgcagctgctgccggggcgcggcgaaaccgtcggcgcccagctggtc
aacgacagccgggtgcgcggcgtcatgtttaccggctcgacggaggtcgccaaacggctg
cagcgcgccgtcgccgatcggctcgatgcccaggggcgcccgacgccgctcatcgccgag
accgggggactcaacgcgatgatcgtcgactcatcggcgctgaccgagcaggttgtaggt
gacattgtcacctccgccttcgacagcgccgggcagcgctgctccgccctacgcctcctc
tgcctgcaggaggagatcgccgagcgaaccctgaccatgctgcgcggggccatggctgaa
taccgcctgggtaacccggagcggctggcgtgcgacatcggcccggtgatcgatagcgag
gcccagagcaatatcgagcagcatatcctcgccatgcgggccaagggacacccggtattc
caggcggcgtgcgcccaggacgacctccagcgcaacgctcggggtaactttgttccgccg
accctgatcgagctggacagcctcaatacgctgcagagggagatctttggcccggtgctg
cacgtggtgcgctaccgtcgcgagcagctggatgcgctgctggcccagatcaacgacgcc
ggctacggcctgaccctcggggtgcattcgcgcatcgacgaaaccatcgaccgcatcgcc
gagcgcgcccacgtcggcaatatctacgttaaccgcaatatcgtcggggccgtcgtcggc
gtgcagcccttcggcggcgagggactctccggcaccggacccaaggccggcggcccgctc
tacctctaccgcctgctggcccgcagcccggaaaacgcgctgacgttcggtgccgatgcc
gcccaccgccagccggacagcgccgcatcgccgctgcaggccctgaacgactgggccgcc
gatcgcccggcgcttcagatcctgtgccagcgctacgccagcctgtaccccggcgccgcc
ccgcgcctgctgggagggccgaccggggagcgtaataccctgcgccttgtcccgcgcgag
cgggtactgtgcgtggcggagcgcgaggacgacgcgctgatccagctggcggcggccctg
gcggtcggctgccgcgtcctgtggccggagacaccgctgcaccgcgcgctgcacaaggat
ctgccgccggcggtggcggcgcgcatcacgctgagcccggcagagaccctaatggcgcag
gcgttcgacgcggcaatctaccacggtgacagcgatcggctacgcctcctcggcgcgcag
atcgccgcccgcgacggcgccatcgtcacgctgcagggcctcgcgcccggcgatacgcgg
ctgcgtctggcgctgttggtccacgagcgcgcgctgagcgtgaataccgcggcggccggc
ggcaacgccagcctgatgaccctgagctag

DBGET integrated database retrieval system