KEGG   Edwardsiella tarda EIB202: ETAE_1670Help
Entry
ETAE_1670         CDS       T01121                                 

Definition
(GenBank) drug resistance transporter, Bcr/CflA subfamily
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ACY84509
UniProt: D0Z7U0
Position
complement(1779790..1781004)
Genome map
AA seq 404 aa AA seqDB search
MRSKSGFMVYLAGLSMLGYLATDMYLPAFGAMRHDLGASAGAISASLSIFLAGFAFAQLL
WGPLSDRIGRKPVLLLGLGMFALACLGMLWVGNTTQLLILRFVQAVGVCSAAVTWQALVI
DRYSKGVANRVFATVMPLVALSPALAPLLGAWLLNHFEWQAIFAVLFAITLLLMIPTLRL
QEHRAAANRQAPRIGFLRLMRSNIFSGNVLIYAACSAGFFAWLTGSPFILGEMGYSPNDI
GLSYVPQTIAFLLGGYGCRALLSRIGGTLLLPWLLVIYSLSMLAMLVMALSYQPGLLALL
VPFCVMAMMNGAIYPIVVASALTPFPNNSGKAAALQNTLQLGVCFLASLLVSALIHMPLL
ATTAIMAGTIPLVVLGYWLKSDSVTTMLEKRREMQQGQHSLSRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtaaatcaggtttcatggtctatctggctggcctcagtatgctgggatatctg
gccaccgatatgtatctgcccgcctttggtgccatgcgccacgatctgggcgcctccgcc
ggcgccatcagcgccagcctgagcatctttctggccggctttgcctttgcacagctgctg
tgggggccgctctccgatcgcatcggacgcaagccggttctgctgttagggctgggcatg
ttcgcgctggcctgcctggggatgctgtgggtcggcaatacgacccagctgctgatcctg
cgcttcgtgcaggccgtcggggtctgctccgcggcggtcacctggcaggctttggttatc
gatcgctacagcaaaggggtcgcgaaccgcgtcttcgcgacggttatgccgctggtggcc
ctctcgccggcgctggcgccgctgctcggcgcctggctgctcaaccactttgaatggcag
gccatcttcgccgtgctgttcgccatcaccctgctgctgatgatcccaaccctgcgtctg
caggagcaccgggcggcggcgaaccgtcaggcaccgcgcatcggtttcctgcgcctgatg
cgctccaatatctttagcggcaacgtcctgatctacgccgcctgctccgccggcttcttc
gcctggctgaccggctcgccgtttattctgggcgagatggggtacagcccgaacgatatc
ggcctgagctatgtgccgcagaccatcgccttcctgctgggtggctacggctgtcgggcg
ctgctgagccgcatcggcggtaccctgctgctgccgtggctgctggttatctactcgctg
agcatgctggcgatgctggtgatggccctcagctaccagcccggtctgctggcgctgctg
gtaccgttctgcgtcatggcgatgatgaacggcgctatctatcccatcgtggtggccagc
gccctgacgcccttcccgaacaacagcggcaaggcggcggcgctgcagaacacgctgcag
ctgggcgtctgcttcctggccagcctgctggtatcggcgctgatccacatgccgctgctg
gcgaccaccgccatcatggccggcaccattccgctggtggtgctggggtattggcttaaa
agtgacagcgtcactaccatgctggaaaaacgccgcgagatgcagcagggccaacactcc
ctctcccgccgctga

DBGET integrated database retrieval system