KEGG   Edwardsiella tarda EIB202: ETAE_1679Help
Entry
ETAE_1679         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
  KO
K07390  monothiol glutaredoxin
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:etr03110]
    ETAE_1679
   03029 Mitochondrial biogenesis [BR:etr03029]
    ETAE_1679
Chaperones and folding catalysts [BR:etr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   ETAE_1679
Mitochondrial biogenesis [BR:etr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    ETAE_1679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ACY84518
UniProt: D0Z7U9
Position
1787958..1788302
Genome map
AA seq 114 aa AA seqDB search
MTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAE
LPKFANWPTFPQLWIEGELIGGCDIVLEMYQRGELQTLIKEAAARHGSAAQDNA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaccactatcgaaaagattcagcgccagatcgccgagaacccgattctgctgtatatg
aaaggctcaccgaagctgccgagctgcggcttttctgcgcaggcggtgcaggcgctgtcc
gcctgcggcgagcgctttgcctacgtggatatcctgcagaacccggacattcgcgccgag
ctgccaaagtttgctaactggccgacctttccgcagctgtggattgagggtgagctgatc
ggcgggtgtgacatcgtgctggaaatgtatcagcgcggcgagctgcagacgctgatcaaa
gaggccgcggcgcgccacggctcagcggcgcaggacaacgcctga

DBGET integrated database retrieval system