KEGG   Edwardsiella tarda EIB202: ETAE_1680Help
Entry
ETAE_1680         CDS       T01121                                 

Definition
(GenBank) putative permease
  KO
K07084  putative amino acid transporter
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etr02000]
    ETAE_1680
Transporters [BR:etr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAE_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_antiporter Na_H_antiport_2 DctM CitMHS GntP_permease
Motif
Other DBs
NCBI-ProteinID: ACY84519
UniProt: D0Z7V0
Position
complement(1788371..1789693)
Genome map
AA seq 440 aa AA seqDB search
MNAVVIAVVVMLLLSLLRVNVVIALIVASLVAGLSGGLTLDTTITTFSGGLGGGAEIALS
YAMLGTFAVAISRSGITDVLAHGVIRRMGLTPSAHRLFWFKYGLLLILTLIAISSQNLIP
IHIAFIPILIPPLLHVFSRMNLDRRAVACVLTFGLITPYMVLPIGFGGIFLNNILLKNLN
ENGLQVTAAQVPSAMLLPGLGMLFGLLLAIFFSYRRPRRYNEGRILSAEPEHKRIHLRAV
WVAVIAIIAALGVQLATNSIVLGALMGFVVFILGGVIHWRDTQDVFTRGVHMMAMIGFIM
ITASGFAAVIKATGSVDTLVTSIEGAIGGNRGLAAFLMLVVGLVITMGIGSSFSTVPIIA
AIYVPLCIAFGFSPMATIAIIGVSGALGDAGSPASDSTLGPTSGLNMDGQHDHIWDSVVP
TFLHYNLPLLGFGWAAAMIL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgttgtaattgccgtggtcgtaatgctgctgctcagcctgctgcgggttaac
gtggtgatcgccctgatcgtcgcctctctggttgccggcctgagcggcggtctcaccctg
gacaccacgatcacgaccttcagcggtgggctgggcggcggcgcggagatcgccctcagc
tacgccatgctgggtacctttgccgtcgcgatttcacgctctgggatcaccgacgtgctg
gcccacggcgtgatccgccgcatggggctgacgccgagcgcccaccgcctgttctggttt
aaatacggtctgctgctgatcctgaccctgatcgccatctcgtcgcagaacctgatcccc
atccacattgcctttattcccattctgatcccgccgctgctgcacgtattttcgcggatg
aacctcgatcggcgcgcggtagcctgcgtgctgaccttcggcctgatcaccccttatatg
gtgctgccgatcggctttggcggcatcttcctgaacaatattctgctgaagaacctcaat
gagaacgggctacaggtcaccgccgcccaggtgcccagcgccatgctgctgccggggctg
gggatgctgttcggcctgctgttggccatcttcttcagctaccgcaggccgcgccgctac
aacgaggggcgcattctgtccgccgagccggagcataagcgtattcatttacgggccgtg
tgggtcgccgttatcgccatcatcgccgccctcggggtgcagctggcgaccaactctatc
gtgctcggcgcgctgatgggctttgtggtgtttattctcggcggcgtgatccactggcgg
gatactcaggatgtctttacccgcggggtgcatatgatggcgatgatcggctttatcatg
atcaccgcctccgggtttgccgccgtgatcaaagccaccggcagcgtagatacgctggtg
acctctatcgagggggcgatcggcggcaaccggggactggctgcgtttctgatgctggtg
gtcgggctggtcatcaccatgggcatcggctcctccttctccacggtgccgatcatcgcg
gcaatctatgtgcccctgtgcattgcctttggcttctcccccatggcgaccatcgccatt
atcggcgtctccggggcgctgggggatgccgggtcgccggcctctgactctaccctgggg
ccaacctctgggctgaatatggacggccagcacgaccatatctgggattcggtggtgccg
accttcctgcactacaacctgccgctgctcggcttcggctgggcggcagcgatgatcctc
tag

DBGET integrated database retrieval system