KEGG   Edwardsiella tarda EIB202: ETAE_1682Help
Entry
ETAE_1682         CDS       T01121                                 

Gene name
gloA
Definition
(GenBank) lactoylglutathione lyase
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAE_1682 (gloA)
Enzymes [BR:etr01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     ETAE_1682 (gloA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_2 Glyoxalase_3 CppA_N
Motif
Other DBs
NCBI-ProteinID: ACY84521
UniProt: D0Z7V2
Position
complement(1790653..1791060)
Genome map
AA seq 135 aa AA seqDB search
MRVLHTMLRVTDLKRSVDFYTQVLGMRLLRTSENEAYKYSLAFVGYGDESQGAVIELTYN
WGVDSYEMGSAFGHIALGVDDVAATVEQIRRAGGNVTREAGPVKGGHTIIAFVDDPDGYK
IELIENRSASEGLGR
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtacttcataccatgctgcgggtcactgacctgaagcgctccgtcgacttctat
acccaggtgctgggcatgcgcctgttgcgcaccagtgaaaacgaagcctataaatactct
ctggccttcgtcggctatggcgatgagagccaaggcgccgtgatcgaactgacctataac
tggggcgtcgatagctatgagatgggcagcgccttcggccatatcgccctcggcgtcgat
gacgtcgccgccaccgtcgagcagatccgccgcgccggcggcaacgttacccgtgaggcg
ggcccggtcaaaggcggtcatacgatcatcgcctttgtcgacgatcccgacggctataaa
atcgagctgatcgaaaaccgctcggctagcgaagggctgggccgctaa

DBGET integrated database retrieval system