KEGG   Edwardsiella tarda EIB202: ETAE_1685Help
Entry
ETAE_1685         CDS       T01121                                 

Gene name
pcpY
Definition
(GenBank) outer membrane lipoprotein
  KO
K06077  outer membrane lipoprotein SlyB
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    ETAE_1685 (pcpY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rick_17kDa_Anti LPAM_1 DUF2076 DUF2577 Gly-zipper_YMGG DUF1269 POR_N Bacteriocin_IIc Gly-zipper_Omp
Motif
Other DBs
NCBI-ProteinID: ACY84524
UniProt: D0Z7V5
Position
complement(1792407..1792874)
Genome map
AA seq 155 aa AA seqDB search
MMKRLIIVAIATATLAGCANTSTLSGDVYSANQAKQVQQVTYGTIVSMEPVQIQAGSEAN
MIGTIGGAVIGGLLGNTIGGGTGRSLATAAGAVAGGVAGNSIEGAVNRTNGVQLVIRLDS
GKTIAVVQKNDKQAFRVNQRVMLLSNGSTVNVSPM
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcgtcttattattgtcgctattgccacggcaaccctggcgggctgtgccaat
accagcaccctgtccggcgacgtgtacagcgccaatcaggccaagcaggtacagcaggtg
acatatggcaccatcgtctccatggagccggtacagattcaagccggtagcgaggcgaac
atgatcggcaccatcggcggcgccgtcatcggggggctgctgggtaacaccatcggcggc
ggcaccggacgcagcctggcgaccgccgcaggcgccgtcgcgggcggcgtggccggcaac
agcattgagggcgcggtcaaccgtaccaacggcgtccagctggtgatccgtctcgacagc
ggtaagaccatcgccgtggtacagaaaaacgacaagcaggctttccgggttaatcagcgc
gtaatgctgctgagcaacggcagcaccgttaacgtctcgccgatgtga

DBGET integrated database retrieval system