KEGG   Edwardsiella tarda EIB202: ETAE_1686Help
Entry
ETAE_1686         CDS       T01121                                 

Gene name
anmK
Definition
(GenBank) anhydro-N-acetylmuramic acid kinase
  KO
K09001  anhydro-N-acetylmuramic acid kinase [EC:2.7.1.170]
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ETAE_1686 (anmK)
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.170  anhydro-N-acetylmuramic acid kinase
     ETAE_1686 (anmK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AnmK
Motif
Other DBs
NCBI-ProteinID: ACY84525
UniProt: D0Z7V6
Position
1793145..1794386
Genome map
AA seq 413 aa AA seqDB search
MALILINVKSIRELGDRLDEIPAAACAARRNTGVEENMKTGRYIGIMSGTSLDGIDVVLA
AIDETLVARQGHYVHPIPHEIKTAILAMSQGQETTLAAVGELDRALGTLYAEAVNQLLQR
QRLTPHDIVAIGCHGQTVWHQPEGSAPFTLQLGDNNRVAALTGIATVGDFRRRDMAYGGQ
GAPLVPAFHHALLAHPGERRMVLNIGGIANLSLLLPGAAVRGFDTGPGNMLMDAWIWRRC
GRPYDADAAWGRGGRVLSALLAQMLADPYFARPAPKSTGRELFNLGWLERHLQRWPGVDA
RDVQATLAELTARSIADQVQLAGGCERLLVCGGGVHNPLVMGRLAALLPGTEVAPTDKYG
VSADDMEALAFAWLAYRTLSGLPGNLPSVTGADRPTLLGAIYPVNPYDTDVVF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttggcgctgatattgataaacgttaagtcgatccgtgagttgggtgataggctggacgaa
ataccggcggcggcctgcgcggcgcgtcgcaacaccggagtcgaagagaatatgaaaacg
ggacgctatatcggcattatgtccggcaccagcctggacggtattgatgtggttctggcc
gcgatcgatgaaacgctggtggcacgccaggggcactacgttcaccccatcccccatgag
atcaagacggcgatcctggccatgagccaggggcaggagacgacgctggcggcggtgggc
gagctggaccgcgccctgggcacgctgtatgccgaggcggtcaatcagctgctgcagcgc
cagcggctgacgccccatgatattgtggccatcggctgccatggacagaccgtctggcat
cagcccgaggggagcgcgccctttacgctgcagctgggggataataaccgcgtagcagcg
ttgaccgggatcgccacggtgggcgattttcggcggcgcgatatggcctacggcgggcag
ggtgccccgctggtcccggcatttcatcatgcgctgctggcccatcccggcgagcgccgc
atggtgctgaatatcggggggatcgccaatttatcgctgctgctgcctggcgcggcggtg
cgcggttttgacaccgggccgggcaatatgctgatggatgcctggatctggcgtcggtgc
ggacgtccgtacgacgccgacgccgcctggggacgcggcggccgcgttcttagcgcgctg
ctggcgcagatgctggcggatccctattttgcgcgtccggcgccgaaaagcaccgggcgg
gagctgtttaacctcggctggctggagcggcacctgcagcgctggcccggcgtggacgcc
cgggatgttcaggcgacgctggcggagctgacggcgcgcagcatcgccgatcaggtccag
ctggccggcggctgcgagcgcctgctggtctgcggcggcggcgtccacaatccgctggtg
atgggccggctggcggcgctgcttccggggaccgaggtcgcaccgaccgataagtacggc
gtcagcgcggatgatatggaggccctggcctttgcctggctggcctaccggacgctctcc
gggctgcccggcaacctgccgtcggtgaccggcgccgatcgtccgacgctgctgggtgcc
atctacccggtcaatccctacgataccgatgtcgttttctaa

DBGET integrated database retrieval system