KEGG   Edwardsiella tarda EIB202: ETAE_1692Help
Entry
ETAE_1692         CDS       T01121                                 

Gene name
tppB
Definition
(GenBank) dipeptide/tripeptide permease
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ETAE_1692 (tppB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-ProteinID: ACY84531
UniProt: D0Z7W2
Position
complement(1798577..1800049)
Genome map
AA seq 490 aa AA seqDB search
MSNANNNQPENVSLNAFKQPRAFYLIFSIELWERFGYYGLQGIMAVYLVKMLGMTEADSI
TLFSSFSALVYGFVAIGGWLGDKVLGAKRVIMLGALVLAIGYAFVAYSGHDLSLVYVGMA
TIAVGNGLFKANPSSLLSTCYEKNDPRLDGAFTMYYMSVNIGSFFSMLATPWLAARFGWS
VAFSLSVVGMLITLVNFMMCRRWVKDQGSKPDFAPLQVGKLMMTLVGVVILVAISTWLLH
NQTIARWALAIISAGIILIFAKETFALQGGARRKMIVAFLLMLEAVVFFVLYSQMPTSLN
FFAIHNVEHSIFGIAFEPEQYQALNPFWIMVASPILAAIYNKMGDRLPMPHKFAIGMVLC
SGAFLVLPWGASFANEAGIVSVNWLILSYALQSIGELMISGLGLAMVAQLVPQRLMGFIM
GSWFLTTAAAALIAGKVAALTAVPGGEVADPHASLAIYSHVFMQIGLATAVIAVLMLLTA
PKLNRMTLGD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaacgcaaacaacaaccaaccggaaaacgtgagtctcaacgcgtttaaacagccc
cgtgctttctatctgatcttctctatcgaactgtgggagcgttttggctattacggcctg
cagggcatcatggccgtttacctggttaagatgctgggcatgaccgaggccgactccatt
accctgttctcatccttcagcgccctggtatacggcttcgtcgctatcggcggctggctg
ggtgacaaggtgctgggtgccaagcgtgtcatcatgctcggcgcgctggttctggccatt
ggctatgcctttgtcgcctactccggccatgatctgtcgctggtctacgtggggatggcg
accatcgcggtcggtaacggcctgtttaaggctaacccctcctcgctgctctctacctgc
tatgagaaaaacgatccgcgcctggatggcgccttcaccatgtactacatgtcggtgaac
atcggttccttcttctctatgctggcaactccgtggctggcggcccgctttggctggagc
gtcgcgttctccctgagcgtcgtgggcatgctgatcaccctggtcaactttatgatgtgc
cgtcgctgggtgaaggatcagggctccaagccggacttcgcaccgctgcaggtcggcaag
ctgatgatgaccctggtcggcgtggtgatcctggttgctatttcaacctggctgctgcat
aaccagaccatcgcgcgctgggcgctggccatcatctccgccggcatcatcctgatcttc
gcgaaagagacctttgcactgcagggcggcgcacgccgtaagatgatcgtcgccttccta
ctgatgctggaagctgtggtcttcttcgtgctgtatagccaaatgccgacctcgctgaac
ttcttcgccatccataacgttgaacacagcatcttcggcatcgcgttcgagccggagcag
tatcaggcgctgaacccgttctggatcatggtcgctagcccgatcctggccgcaatctac
aacaagatgggcgaccgcctgccgatgccgcacaagtttgctatcggtatggtgctgtgc
tccggcgcgttcctggtgctgccatggggcgcatccttcgccaatgaagcggggattgtg
tcggttaactggctgatcctgagctatgcgctgcagagtatcggcgagctgatgatctcc
ggtctgggtctggccatggtggcacagctggtgccgcagcgactgatgggctttatcatg
ggctcgtggttcctgaccaccgccgccgccgcgctgatcgccggtaaagtggctgcgctg
accgccgtaccgggcggtgaggttgccgatccgcacgcctcactggctatctatagccac
gtatttatgcagatcggcctcgctaccgccgtcatcgcggtgctgatgctgttgaccgca
ccgaagctgaaccgtatgaccctgggcgattaa

DBGET integrated database retrieval system