KEGG   Edwardsiella tarda EIB202: ETAE_1693Help
Entry
ETAE_1693         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACY84532
UniProt: D0Z7W3
Position
1800379..1800531
Genome map
AA seq 50 aa AA seqDB search
MYLIVLNYRLFPKSSNQATYRHQSKNNINDLNVINLKIMTTKVLALWKIK
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
ttgtatttgattgtactaaattatcgtctttttccaaaatcatcaaatcaagcaacatat
cggcatcaatcgaaaaataatattaacgatttaaatgtgatcaacctcaaaattatgaca
acgaaagtgcttgcactgtggaaaataaagtga

DBGET integrated database retrieval system