KEGG   Edwardsiella tarda EIB202: ETAE_1714Help
Entry
ETAE_1714         CDS       T01121                                 

Definition
(GenBank) dethiobiotin synthetase
  KO
K01935  dethiobiotin synthetase [EC:6.3.3.3]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00780  Biotin metabolism
etr01100  Metabolic pathways
Module
etr_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETAE_1714
Enzymes [BR:etr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.3  dethiobiotin synthase
     ETAE_1714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_26 CbiA DUF1611
Motif
Other DBs
NCBI-ProteinID: ACY84553
UniProt: D0Z7Y4
Position
1822572..1823237
Genome map
AA seq 221 aa AA seqDB search
MLKRVFVTGTDTEVGKTVASRALLQAIQAAGHSAVGYKPIAVGSDETPQGLRNRDAVTLL
NASSMALSYDEVNPVTLREEIANAYTGEALDYGAMSRGLQHLSAKSQHVVVQGTGGWRVL
MQDLRPLSEWVVQEQLPVILVVGIKLGCISHAILTAQAIINDGLPFVGWIANRINPGLSH
YAETIDALRQKLPAPQLGEIPYLYRPEEKALARYIDLSALD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacgcgtattcgttacgggaaccgacaccgaggtgggtaaaacggtggcttct
cgtgcgttattacaagctattcaggcggctggacacagtgcggtggggtataaacctatc
gccgtaggcagtgatgagaccccgcaggggctccgcaatcgagatgccgtcacgctgctc
aacgcgtcctccatggcgctaagctatgacgaggtcaatcctgtcaccctgcgcgaagag
atagctaatgcctataccggcgaggcgctggactacggcgccatgagccgtggactacag
catctgagtgccaagtcgcagcatgtcgtggtgcagggaaccggcggctggcgggtattg
atgcaggatttacgcccgctctccgaatgggttgtgcaggagcagctcccggtgatcctg
gtggtagggattaagctgggctgtatcagccatgccatcttgaccgcccaggccattatt
aatgatggcctgccgtttgtcggctggattgcaaaccggattaaccccggcctgtcgcac
tatgctgaaaccattgatgctctgaggcagaagctgccggcgccgcagctgggagagatt
ccctatctgtaccgcccagaggaaaaagcgctggcacgctatatcgatttgtccgcgctg
gactga

DBGET integrated database retrieval system