KEGG   Edwardsiella tarda EIB202: ETAE_1718Help
Entry
ETAE_1718         CDS       T01121                                 

Definition
(GenBank) beta-glucoside-specific PTS system components IIABC
  KO
K02755  PTS system, beta-glucoside-specific IIA component [EC:2.7.1.-]
K02756  PTS system, beta-glucoside-specific IIB component [EC:2.7.1.-]
K02757  PTS system, beta-glucoside-specific IIC component
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr02060  Phosphotransferase system (PTS)
Module
etr_M00271  PTS system, beta-glucoside-specific II component
Brite
KEGG Orthology (KO) [BR:etr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ETAE_1718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etr02000]
    ETAE_1718
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     ETAE_1718
Transporters [BR:etr02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Beta-glucoside-specific II component [MD:M00271]
    ETAE_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB
Motif
Other DBs
NCBI-ProteinID: ACY84557
UniProt: D0Z7Y8
Position
1826357..1827835
Genome map
AA seq 492 aa AA seqDB search
MDSQRGAPHAQYQALAQDILHLIGGKENVASLLHCATRLRFRLNDPALADAEGVKACPGI
ITVVESGGQFQVVIGNHVHDVWLAVLHASGQSEDDAPSSPGGNSTVMGKAIDIVSGIFTP
FIGVLAATGIVKGLLALAEVCGWLNPAGATYKIWFAAGDALFFFFPLFLGYSAGKKFGGN
PFITMAIGAALLHPLMIRAFEASLAPGAATEYFLGIPVSFINYSSSVIPIILAAWLSCWL
ERHCSRWLPAAMKNFFTPAICLSVVVPLTFLMIGPLATWLSQLLANGYQAVYTLAPWIAG
VVLGALWQVCVVFGLHWGLVPLMLNNMAVVGHDSMAPMLIPAVMGQVGAVLGIFLRTRDV
QQRVLAGSALSAGIFGITEPAIYGLNLPLRRPFIFGCIAGAIGGGIAGFSGTQIYSVGFA
NFFAIAQMIPPQGVDASVWGGAIGIFAALFIACGLTMMAGLPRASAEATRSSEQMKATAH
ADADIERNAPHR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggatagccaacgtggggcgccgcatgcgcagtatcaggcgctggcgcaagatattttg
catttgattggtggcaaagagaatgtggcaagcctactgcactgcgcgacgcgtctgcgc
tttcgattaaacgatcccgcgttggccgatgcggaaggcgtgaaagcgtgccccggcatt
attacggttgtagaaagcggcggccagtttcaggtggtgatcggcaaccatgtgcatgat
gtttggctagcggtactccatgcgagtgggcagagcgaagatgatgcgccttcgtcgccg
ggcggaaatagcaccgtgatggggaaagcgatcgatattgtctccggtatctttaccccc
tttatcggtgtcttagcggcgacggggatcgtgaaagggctgctggcgctggccgaagtc
tgcggctggctcaatcccgccggcgccacctataaaatctggtttgcggcgggcgatgca
ctgttcttctttttccctctgtttcttggctacagcgccgggaaaaaatttggcggcaat
ccgtttattaccatggcgatcggcgctgcgctgctgcatccgctgatgattcgcgccttt
gaggccagcttagcgccgggggcggccacagagtattttctggggatcccggtcagcttt
attaactacagttcatcggtgatccctatcattcttgccgcctggctcagctgttggcta
gagcgccactgcagccgatggctgccggcggcgatgaaaaatttcttcaccccggctatc
tgtctgtcggtcgtcgttccgctgacctttctaatgattggaccgctggcgacctggctg
agccagctgctagcgaatggctatcaggccgtttatacattagcgccgtggatcgcgggg
gttgtgctcggggcgctctggcaggtttgcgtggtctttggcctgcactgggggctggtg
ccgctcatgctcaataacatggccgtggtggggcatgactctatggcgccgatgctgata
ccggcggtgatgggacaggtgggggcggtgctggggatcttcctgcgcactcgcgatgtt
cagcagcgggttctggcgggatccgcgctatccgccgggatttttggcattaccgagccc
gctatctatggtctgaatctaccgctgcgtcgtccttttatcttcggctgtatcgctggc
gctattggcggcggaattgccggcttcagcgggacgcaaatctactctgtcggctttgcc
aatttcttcgctatcgcacagatgatcccgcctcagggcgtggatgcgtcggtctggggg
ggcgccatcgggatcttcgccgcgctgtttatcgcctgtgggctgaccatgatggccggg
ctgccgcgcgcgtcggccgaggctacgcgctcaagcgagcagatgaaggcgactgcgcac
gctgatgcggatattgagcggaatgcaccgcataggtaa

DBGET integrated database retrieval system