KEGG   Edwardsiella tarda EIB202: ETAE_1722Help
Entry
ETAE_1722         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1161 DUF4222
Motif
Other DBs
NCBI-ProteinID: ACY84561
UniProt: D0Z7Z2
Position
complement(1832509..1832781)
Genome map
AA seq 90 aa AA seqDB search
MHKPILFSALLLAPLFSYAAVSSCETIRDEISQKIVANGVPQDAFTLEIVPNDQVQQANG
QVVGHCGNDTQKIIYIRTDGAEPGAHATPR
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgcataaacctatcttattctccgccctgctcctggcaccgttgttctcttatgccgcc
gtctcctcctgcgaaaccatccgggatgagattagccagaagatcgtagccaacggcgtc
ccgcaggacgcctttacgctggagatcgtccccaacgatcaggtacagcaggcgaacggt
caggtcgtgggtcactgcggtaacgacacacagaaaattatctatatccgtaccgacggc
gccgaacctggcgcccacgcgacgccacgctaa

DBGET integrated database retrieval system