KEGG   Edwardsiella tarda EIB202: ETAE_1723Help
Entry
ETAE_1723         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1283 FAM176 CBM_1 Inhibitor_I36 DDRGK K_channel_TID
Motif
Other DBs
NCBI-ProteinID: ACY84562
UniProt: D0Z7Z3
Position
complement(1832796..1833131)
Genome map
AA seq 111 aa AA seqDB search
MIPLLLLLGGIGWQSAAQAASCEAGSTCVFGSSGGQDNSLTKEQAREQREQWDQTRPLRS
KVNTHVEKEFDKADRAIEQRERCERSLNVNAYWEPGTRRCLDRQSGRPLTP
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
ttgattcccctgctgctactgctcggcggcatcggttggcaaagcgccgcgcaggccgcc
agctgcgaggctggcagcacctgcgtctttggctccagcggtggacaagacaactcgctg
accaaagagcaggcgcgtgaacagcgggagcaatgggaccaaacccgccctttgcgtagt
aaggtcaacacgcacgttgagaaagagtttgataaggccgatcgggccatcgaacagcga
gagcgctgtgagcgcagtttgaacgtcaacgcctactgggaaccagggacgcgccgctgc
ctggatcgtcagagcgggcgtccgttaactccctaa

DBGET integrated database retrieval system