KEGG   Edwardsiella tarda EIB202: ETAE_1725Help
Entry
ETAE_1725         CDS       T01121                                 

Definition
(GenBank) chain length determinant protein
  KO
K05789  chain length determinant protein (polysaccharide antigen chain regulator)
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:etr01005]
    ETAE_1725
Lipopolysaccharide biosynthesis proteins [BR:etr01005]
 O-antigen
  ETAE_1725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzz GNVR BRCA-2_helical DUF1525
Motif
Other DBs
NCBI-ProteinID: ACY84564
UniProt: D0Z7Z5
Position
1834282..1835235
Genome map
AA seq 317 aa AA seqDB search
MHEKPVNHVNDEIDLLDIIRQLWQGKVIVFCVSIMFLAIAGLYIMLTTPKWTAESTLSKP
YLNQLANYPAGVMLSQVWTMNDGDNAPVIDDAKITGNVFNTFIAMANAQILSGMDISIRP
GTTAETFIVSSTANDPALAKKNLQSALISLSDDARKQLDALMYSSLRERANSLKIQMQAQ
ENSARAQRDYRISVLKNALQLANQMNIQQTKLNPASGEISDDMLFMLGVPILNTMIEHEK
NLPLKFNASYFDMQEMFDSINGFKLTEDNLSIFNATNISVDKVGQKRALILVLSLLLGVI
LSCGYILLRNALRSANK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaaaccagtaaaccatgtcaatgatgagatcgatctgcttgatatcattagg
cagctatggcaagggaaagtgattgttttttgtgtttcaatcatgtttctcgctatcgct
ggcctttatatcatgttgactacgccaaaatggacggcggagtcaacgctttcgaagcct
tatcttaaccaattggcaaattatcccgcaggggtcatgctgagccaggtctggacgatg
aatgacggggataacgcccccgttatcgatgatgccaaaataaccggcaatgtatttaat
acgtttatcgctatggctaatgctcaaattctctccgggatggatatcagtattcgtccc
ggcaccaccgccgagacgtttattgtttcctcaacggcaaacgatccggcactggcgaag
aaaaacttgcaatcagccttaatttcgctgagtgatgatgcgcgtaagcagctggatgcg
ttgatgtacagttcgctacgtgaacgcgctaatagcttgaaaatacagatgcaggctcag
gaaaatagcgccagagcgcagcgagactatcgcattagcgtgttgaaaaatgcgctacag
ctggcgaaccagatgaatatccaacagaccaagcttaacccggcatccggagaaatatct
gatgatatgctgtttatgcttggcgttccaatcttaaacacaatgattgagcatgaaaaa
aacttaccgctgaagtttaacgccagctattttgacatgcaggaaatgtttgattcgatt
aatggattcaagctcactgaagataatttatccatattcaatgcgactaatatatcggtg
gataaagtagggcaaaagcgtgctttaattttggtcttgtccttactgctgggtgtgatt
ttaagctgcgggtatatcttgttgagaaacgcactgcgtagcgctaacaaataa

DBGET integrated database retrieval system