KEGG   Edwardsiella tarda EIB202: ETAE_1733Help
Entry
ETAE_1733         CDS       T01121                                 

Definition
(GenBank) outer membrane protein induced after carbon starvation
  KO
K07285  outer membrane lipoprotein
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    ETAE_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Slp
Motif
Other DBs
NCBI-ProteinID: ACY84572
UniProt: D0Z803
Position
complement(1843504..1844085)
Genome map
AA seq 193 aa AA seqDB search
MMKCRHSLFAAAICAPLILSGCAAIPGDIQGNNSPILQKDFNQIRMAPNLYTGQQVRLGG
RVINVINQPKQTLLEIAVLPLNSAARPQLDQHYQGRLIARSDRFLDPVNYRHHLVTVLGT
LSGSEVGKIGSSPYTFVMLNIQGIQLWQVSETQPPVAAWDYGIGPNWPLTWQNNRDPGWG
WYPVLQPETASTH
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtgccgacattcactattcgccgcggcgatctgtgcaccgttaatactcagc
gggtgcgccgccattcccggcgatatacagggtaacaacagcccgatactgcaaaaagat
tttaaccagatccgcatggcgcccaatctctacacgggtcagcaggttcgcctgggtggg
cgagtgattaacgtgattaatcagcccaaacagacgctgctggagatcgccgtgctgccg
ttaaacagcgccgccagaccgcagctagatcagcattatcaaggacgacttatcgcccgt
agcgatcgcttcctcgatccggtcaactaccgtcatcatctggtcacggtattgggaacc
ctcagcggcagcgaggtgggtaaaataggctcgtcaccctatacctttgtcatgctgaac
attcagggcattcaactctggcaggtgagcgaaacgcagccgccggtggcggcctgggac
tacggcattggacctaactggccgctgacctggcaaaacaatagggatcccggctgggga
tggtacccggtgctacagccggaaacggcttctacacactaa

DBGET integrated database retrieval system