KEGG   Edwardsiella tarda EIB202: ETAE_1739Help
Entry
ETAE_1739         CDS       T01121                                 

Gene name
asrB
Definition
(GenBank) anaerobic sulfite reductase subunit B
  KO
K16951  anaerobic sulfite reductase subunit B
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00920  Sulfur metabolism
etr01100  Metabolic pathways
etr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ETAE_1739 (asrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 DHODB_Fe-S_bind FAD_binding_6 CIAPIN1 NAD_binding_6
Motif
Other DBs
NCBI-ProteinID: ACY84578
UniProt: D0Z809
Position
complement(1848160..1848978)
Genome map
AA seq 272 aa AA seqDB search
MCNGNCEHRHQVLLPAAYPILEIEKHTALEWNFRVACDFPLHYGQFVEVSLPLVGEAPIS
VSDYGDGWVDLLIRRVGHVTDALFALQAGDKVWLRGAYGNGYDLSQFYDKRLIVVAGGTG
VAPVKGLMRHFCEHPQQVKSLDMILGYKNPDSVLYKRELDFWRSRHNLCLTLDEGDTIAE
YYHLGRVTDHLPYLDFSAPEEIQAIVVGPPVMIRATVAMLQKNGLRDEQIWVDYERRMAC
SVGKCGHCRMGDVYICVDGPVFNYADARAMVD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacggtaactgtgaacatcgtcaccaggtgctgctgccagcggcatacccgatt
ctggagattgagaaacatacggcgctggagtggaactttcgcgttgcctgcgactttccg
ctgcactatggccagtttgtggaggtctctctgccgctggtcggcgaggcgccgatatcc
gtgtccgactatggcgatggctgggttgatctgctgatccgccgggtaggccacgtgacc
gacgcgctgtttgcgctgcaggccggtgataaggtctggctacgcggcgcctacggcaac
ggctatgacctgagccagttttacgataagcgcctgatcgtggtcgccggcggtaccggc
gtcgcgccggtaaaagggctgatgcgccatttttgcgaacatccgcagcaggtgaaaagc
ctggatatgatcttaggctataagaatccggacagcgtcctgtacaaacgcgagctcgac
ttctggcgcagccggcacaatctgtgtctgaccctggatgagggcgacaccatcgccgaa
tactatcacctggggcgcgtgaccgaccatctgccgtacctggacttcagcgcgccggag
gagatccaagccattgtggtcgggccgccggtgatgatccgagcgacggtcgccatgctg
cagaaaaacggtctgcgggatgaacagatttgggtcgactatgagcgtcgcatggcctgc
tctgtcggcaagtgcggccactgccgcatgggagatgtctatatctgtgtcgatgggccg
gtgtttaactatgccgacgctcgcgccatggttgactga

DBGET integrated database retrieval system