KEGG   Edwardsiella tarda EIB202: ETAE_1748Help
Entry
ETAE_1748         CDS       T01121                                 

Gene name
pntA
Definition
(GenBank) NAD(P) transhydrogenase, alpha subunit
  KO
K00324  NAD(P) transhydrogenase subunit alpha [EC:1.6.1.2]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00760  Nicotinate and nicotinamide metabolism
etr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ETAE_1748 (pntA)
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     ETAE_1748 (pntA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N PNTB_4TM 2-Hacid_dh_C DUF3392 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ACY84585
UniProt: D0Z816
Position
complement(1856175..1857701)
Genome map
AA seq 508 aa AA seqDB search
MRIGVPKERLANEARVAATPKTVEQLLKLGFTVAIESGAGKLASFEDAAYQQAGAEVVEL
DEVWQSDVILKVNAPDDDEIARIKAGATLISFIWPAQNQALLEKLAERQVTVMAMDSVPR
ISRAQSMDALSSMANIAGYRAIVEAAHEFGRFFTGQITAAGKVPPAKVMVIGAGVAGLAA
IGAAGSLGAIVRAFDTRPEVKEQVQSMGAEFLELDFEEEAGSGDGYAKVMSEAFIKAEMA
LFAAQAQEVDIIVTTALIPGKPAPRLITKEMVATMKPGSVIVDLAAQTGGNCELTQADRV
VTTENGVKIIGYTDLPSRLPTQSSQLYATNQVNLLKLLCKEKDGTLNVDFEDVIIRGVTV
VRTGEITWPAPPIKVSAQPQAAKAEPVTAPVAKPTSPLKKYLLMALAIVLFGWMASVAPK
EFLSHFTVFALSCVVGYYVVWNVSHALHTPLMSVTNAISGIIVVGALLQIGHGGWITFFA
FIAVLIASINIFGGFTVTQRMLKMFRKN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattggtgtaccaaaagagcggttggccaatgaagcccgcgtagcggcgacgccg
aaaacggtagagcagctgctaaagctgggtttcacggtggcaatcgaaagcggcgcagga
aaactggccagctttgaggatgcagcctatcagcaggccggcgccgaggtggttgaactt
gacgaggtttggcagtctgacgtgatattaaaggtcaacgcgccggatgatgatgaaatt
gcccgcattaaggcaggcgctaccctgataagctttatctggccggcgcagaaccaggcg
cttttggagaagctggccgagcgtcaggtcacggtgatggcgatggattcggtgccgcgt
atttcgcgtgcccagtcgatggacgccctcagctccatggcaaacatcgccggttaccgg
gccatcgtggaggcggctcatgaatttggccgcttctttaccggtcagatcacggcggcg
ggtaaggtgccgccggcgaaggtgatggtgatcggcgccggcgttgccggtctggccgcc
atcggcgctgccggtagcctcggcgccatcgttcgcgccttcgatacccgtccagaagtc
aaagagcaggtgcagagtatgggcgccgagtttctggagctggactttgaagaagaggcc
ggcagcggcgacggctatgccaaagtgatgtcggaggcctttatcaaggccgagatggcg
ctgttcgccgcccaggcgcaggaggtggatatcatcgtcaccacggcgctgatcccgggg
aaaccggcgccgcgcctgatcaccaaagagatggtcgccaccatgaagccgggcagcgtg
atcgtcgatctggcggcgcagaccggcggcaactgcgagctgacgcaggccgatcgggtc
gtgaccacggaaaacggcgtcaagatcatcggctataccgatctgccgagccgtctgccg
acccagtcatcccagctgtatgctaccaaccaggtcaatctgctcaagctgctgtgcaaa
gagaaagatggcacccttaacgtggactttgaggatgtgatcatccgcggggtgaccgtg
gtgcggacgggagagatcacctggccggcgccgccgatcaaggtttccgctcagccgcag
gccgctaaggctgagccggtgaccgcccccgtagccaagccgacgtcgccgctgaagaag
tacctgctgatggccctggccatcgtgctgttcggctggatggccagcgtggcgccgaag
gagttcctatcgcacttcaccgtgtttgcgctctcctgcgtagtgggctactacgtggtc
tggaacgtcagccatgcgctgcatacgccgctgatgtcggtcactaatgccatctccggc
attattgtcgtcggtgcgctgctgcagattgggcacggcggttggatcacgttctttgct
tttattgcggtgctgatcgccagtatcaatattttcggtggtttcaccgtcacccagcgc
atgctgaaaatgtttcgtaaaaactga

DBGET integrated database retrieval system