KEGG   Edwardsiella tarda EIB202: ETAE_1753Help
Entry
ETAE_1753         CDS       T01121                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00670  One carbon pool by folate
etr00790  Folate biosynthesis
etr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETAE_1753
   00670 One carbon pool by folate
    ETAE_1753
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ETAE_1753
    1.5.1.50  dihydromonapterin reductase
     ETAE_1753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR CcdB Wax2_C
Motif
Other DBs
NCBI-ProteinID: ACY84590
UniProt: D0Z821
Position
1862151..1862873
Genome map
AA seq 240 aa AA seqDB search
MDTLSMPPVVITGGARRVGLALALSLLAREIPVLVAYRSEYPALASLRQAGAHCLQSDFS
TTEGIYDFAARVQRITPRLRALIHNASAWQAERPDVAPEQTLNAMLQIHVHTPYLLNLLL
EPLLRGQGDAGADIIHLTDYVVERGSDSHIAYAAGKAALDNMTRSFARKLAPEVKVNAIA
PALILFNPQDDEAYRQKALDKSLMKIAAGEQEIVNAIDFLLNSRFITGRTIGVDGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggatacgctgtccatgccgccggtggtgatcaccggcggcgcccgccgcgtcggactg
gcgctggccctctccctgcttgccagagagatccccgtactggtggcctaccgcagtgaa
taccctgccctggcctcgctgcgtcaggccggggcgcactgcctacagagtgacttctcg
acgacggaggggatctatgacttcgccgcgcgggtgcagcgcatcacgccccgcctgcgg
gcgctgatacacaacgccagcgcctggcaggccgaacgccccgacgtagcgccggagcag
acgctcaatgccatgctgcagatccatgtccacacgccctacctgctgaatctgctgcta
gagccgctgctgcgtgggcagggagacgccggcgccgatatcatccatttgaccgattat
gtcgtggagcgcggcagcgatagccatatcgcctatgccgccggcaaggccgcgctggac
aatatgacgcgctcctttgcccgcaagctggcgccagaggtcaaggtcaacgccatcgcc
ccggcgctgatcctgttcaatccgcaggatgatgaggcctatcggcaaaaagcgctggat
aagtcgctgatgaaaattgccgcaggcgaacaagagattgtcaatgccattgacttcctg
ttgaatagtcgtttcattaccggtcgtaccataggggtcgacggtggccgtcccctgcgc
taa

DBGET integrated database retrieval system