KEGG   Edwardsiella tarda EIB202: ETAE_1763Help
Entry
ETAE_1763         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
  KO
K03827  putative acetyltransferase [EC:2.3.1.-]
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ETAE_1763
Enzymes [BR:etr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     ETAE_1763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 FR47 DUF3749 Acetyltransf_4
Motif
Other DBs
NCBI-ProteinID: ACY84600
UniProt: D0Z831
Position
1873199..1873450
Genome map
AA seq 83 aa AA seqDB search
MFLHDGHLEALFVDASARGLGVGKRLISHALALHPDLSVDVNEQNQQAVGFYQHMGFNVS
GRSDLDSQGRPYPLLHLRKADGC
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgcatgatggccatctagaggcgctttttgtcgatgcttctgcgcgcgggctt
ggcgtcggcaaacggttgatatcacatgcactggcgcttcaccctgatttaagcgtcgat
gtaaatgaacaaaaccagcaggccgtagggttttatcaacatatgggctttaacgtctca
gggcgttccgacctggatagccagggaaggccgtatcccctattacacctgcgcaaagcc
gacggatgttaa

DBGET integrated database retrieval system