KEGG   Edwardsiella tarda EIB202: ETAE_1766Help
Entry
ETAE_1766         CDS       T01121                                 

Definition
(GenBank) putative pepetidase
  KO
K04775  protease YdgD [EC:3.4.21.-]
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:etr01002]
    ETAE_1766
Enzymes [BR:etr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     ETAE_1766
Peptidases [BR:etr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   ETAE_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-ProteinID: ACY84603
UniProt: D0Z834
Position
1874781..1875593
Genome map
AA seq 270 aa AA seqDB search
MRFPALLSITLLLTPWLPHAALADDGLTPAQQRQLFFGHDDRDRVSEVADGPWNAIGQVE
TASGNLCTATLIAPRWALTAGHCLLAPPGKTDRAVALRFISQDGKWRYQSRHLQTRVNPQ
LYKKLKADGDGWIVPPAAAPQDYGLVEITAGPLPDLRPLPVWQGTPKALSAALKAQHRQV
TQAGYPQDHLDVLYRHRDCLITGWAQSGVLSHRCDTLPGDSGSPLLMRQATGWTLVAIQS
SAPAAENRALADNRAVAVTAINAGLQRLMR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttccctgcccttttgagcattacgctgttattgactccctggctaccgcacgcc
gccctggcggatgacgggcttacccccgctcagcagcgacagctgttcttcggtcacgac
gatcgcgatcgcgtcagtgaggtcgccgacgggccatggaacgccatcggccaggtcgaa
accgccagcggcaacctgtgcaccgccaccctgatcgcgccgcgctgggcgctgacggcg
ggccactgtctgctggcaccgccgggaaaaaccgatcgcgccgtagcgctgcgctttata
tctcaggacggtaagtggcgctaccagtcacgccatctacagacgcgggtcaatccgcag
ctgtacaaaaagctcaaggccgacggcgatggctggattgttccgcctgcggcggcgccg
caggattatggattggtggagatcacggccggtcccctgcccgatctgcgtccgctgccg
gtatggcaagggacaccgaaagcgctgagcgcggcgctgaaggcgcagcaccgccaggtg
acccaggccggctatccgcaggatcatctggatgtgctctatcgccatcgcgactgcctc
atcaccggttgggcacagagcggcgtgctgagccaccgctgcgatacgctgccgggcgac
agcggatcgccgctgctgatgcgtcaggcgaccggatggacgctggtcgcgatccaaagc
tcggcgccggcggcggaaaaccgggcgctggccgataatcgcgccgtcgccgttaccgcg
attaacgcggggctgcagcgtctaatgcgctga

DBGET integrated database retrieval system