KEGG   Edwardsiella tarda EIB202: ETAE_1777Help
Entry
ETAE_1777         CDS       T01121                                 

Gene name
qacE
Definition
(GenBank) membrane transporter
  KO
K03297  small multidrug resistance pump
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etr02000]
    ETAE_1777 (qacE)
Transporters [BR:etr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAE_1777 (qacE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA TMEM234
Motif
Other DBs
NCBI-ProteinID: ACY84614
UniProt: D0Z845
Position
complement(1886113..1886445)
Genome map
AA seq 110 aa AA seqDB search
MNGYLYLAMAIGAEVIATTALKATQGFSRLGPSLVVVVGYAIAFWGLSQVVKSIPLGVAY
AIWSGMGIVLVSLAAYWLYQQTLDWAALLGMAMIVGGVLVINLFSHTSAH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatatctgtatctggcgatggcgatcggcgccgaggtgatcgccacgaccgcc
ctgaaagccacccaggggtttagccgactcggcccgagtctggtggtggttgttggatat
gccattgctttctggggactttctcaggtagtgaagagcatcccgctgggcgtcgcctat
gcgatttggtccggtatggggatcgtgctggtctcgctggccgcctactggctgtaccag
cagacgctcgactgggcggcgctgctggggatggcgatgatcgtcgggggcgtgctggtg
attaatttattctcccacacgtcggcacattaa

DBGET integrated database retrieval system