KEGG   Edwardsiella tarda EIB202: ETAE_1778Help
Entry
ETAE_1778         CDS       T01121                                 

Gene name
nifJ
Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00010  Glycolysis / Gluconeogenesis
etr00020  Citrate cycle (TCA cycle)
etr00620  Pyruvate metabolism
etr00650  Butanoate metabolism
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01120  Microbial metabolism in diverse environments
etr01130  Biosynthesis of antibiotics
etr01200  Carbon metabolism
Module
etr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_1778 (nifJ)
   00020 Citrate cycle (TCA cycle)
    ETAE_1778 (nifJ)
   00620 Pyruvate metabolism
    ETAE_1778 (nifJ)
   00650 Butanoate metabolism
    ETAE_1778 (nifJ)
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ETAE_1778 (nifJ)
    1.2.7.-  
     ETAE_1778 (nifJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N POR EKR PFOR_II Fer4_7 Fer4_16 TPP_enzyme_C Fer4 Fer4_9 Fer4_6 Fer4_21 Fer4_10 Fer4_17 Fer4_8 Fer4_2 Transketolase_C Fer4_18
Motif
Other DBs
NCBI-ProteinID: ACY84615
UniProt: D0Z846
Position
1886643..1890173
Genome map
AA seq 1176 aa AA seqDB search
MITIDGNSAVASVAYRASEVIAIYPITPSSGMAEQASAWSADGRPNVWGDIPRVVEMQSE
GGAIAAVHGALQTGALATSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALIAHIASLNSRLPFIHFFDGFRTSHEINKIV
PLADDTLQTLLPAQAIAAHRAHALTPEHPVIRGTSANPDTYFQAREASNPWYDAAYDHVA
DAMQAFADQCGRRYQPFEYDGDPEATRVIVVMGSACGTCAEVCDMLRARGEKVGVLKVRL
YRPFSARHLLAALPLSAQRIAVLDRTKEPGALGEPLYLDVIAALAQAVSSGERAALPLTI
GGRYGLSSKEFGPDCALAVFEALETPRPRPRFTVGINDDVTHLSLPRRTDVHPVSNRLEA
LFYGLGSDGTVSAAKNNIKIIGNSTPLHAQGYFVYDSKKAGGLTVSHLRVRETPIHSAYL
VEQADFIGCHQWQFIERYQMVERLRLGGIFLLNTPYAADEAWARLPQEVQALLNARQAKF
YVINAARIARECRLGARINTVMQMAFLHLSDLIPNGGALPLLQDAIARSYANKGQEIVER
NWQALGAVEGALHAVPLRPVDAESPRRPPIVADQAPDFVKTVTAAMLAGLGDSLPVSAFP
PDGTWPVGTTRWEKRNIAEAIPIWQPALCTQCNHCVAACPHAAIRAKVVAPAALEHAPAT
LESLEVRARDLRGERYVLQVAPEDCTGCNLCVTVCPAADRQDPSVKAINMQPRLAHLARE
KAHYDAFLALPEIDRRRLERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLFGDRML
IANATGCSSIYGGNLPTSPYTTDAQGRGPAWANSLFEDNAEFGLGFRLSAQQHRQRALRL
LHALAGQLPEALVAALQQEETPTETRRQQIAALRAALATLDDPQAQALAQTADALVEQSI
WLIGGDGWAYDIGFGGLDHVLSLSENVNVLVLDTQCYSNTGGQQSKATPLAAVTKFGEHG
KRKARKDLGVSMMMYGHVYVAQISLGAQLNQTVKALQEAESYPGPSLVIAYSPCEEHGYD
LADSHEQMKRLTANGFWPLYRFDPRRGAEGQNALALDSRPPSGDLAQTLLAEQRFRRLNS
LAPQEAQTLYREAEENLRQRFALLSLLAGKTPPATE
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccattgacggtaacagcgcagtggcgtccgtggcctatcgagccagcgaagtc
attgccatctatccgattacccccagctcaggcatggccgagcaggcctccgcctggtcc
gccgacggacgccccaacgtctggggcgatattccacgcgtcgtcgagatgcagtctgag
ggcggcgccatcgccgccgtacacggcgcgctgcagaccggggcactggccaccagcttt
acctcatcccaggggctgctgctgatgatccccaccctgtataagctggctggcgaatta
acccccttcgttctgcacgtcgccgcgcgcaccgtcgccacccatgcgctctccattttc
ggcgaccactccgacgtcatggcggtacgccagaccggctgcgctatgctgtgcgccgcc
agcgtgcaggaggcccaggatttcgccctgatagcccatatcgcctccctcaacagccgt
ctgccgtttatccacttcttcgacggtttccgcacctctcacgaaatcaacaaaatcgtg
ccgctggccgacgatacgctgcagacgctgctgccggcgcaggccatcgccgcccaccgc
gcccatgcgctgaccccggagcacccggtgatccgcggaacctccgccaacccggacacc
tattttcaggcacgagaggccagcaacccgtggtacgacgccgcctatgaccacgtggcc
gacgccatgcaggccttcgccgaccagtgcgggcgccgctaccagccgtttgaatacgat
ggcgatcccgaggccacccgggtcatcgtcgtgatgggctccgcctgcggcacctgcgcc
gaggtgtgcgatatgctgcgcgcgcgcggggagaaggtgggcgtactgaaggtgcggctg
taccgtcccttctccgcccgtcacctgctcgccgcgctgcccctctccgcgcagcgcatc
gcggtgctcgaccgcaccaaagagccgggggcgctgggcgagccgctgtacctggacgtc
atcgccgcgctggcgcaggcggttagcagcggcgaacgcgccgcgctgccgctcaccatc
ggcgggcgctacggcctttccagcaaggagtttggccccgactgcgccctggcggtattt
gaggcgctggagaccccgcggcctcgaccgcgttttaccgtgggcatcaacgacgacgtg
acccacctctccctgccgcgccggacggatgtccacccggtgagcaaccggctggaggcg
ctgttctatgggctgggcagcgacggcaccgtctcggcggcgaagaacaacatcaagatt
atcggtaacagcacgccgctgcatgcccagggctactttgtctatgactccaaaaaggcc
ggcggcctgaccgtgtcacacctgcgagtacgggaaacgcccattcactccgcctacctg
gtggagcaggccgactttatcggctgccaccagtggcagttcattgaacgctatcagatg
gttgagcgtctgcgcctcggggggatcttcctactaaataccccctatgccgcagacgag
gcgtgggcgcggctgccccaggaggtgcaggcgctgctcaacgcacggcaggcgaagttc
tacgttatcaacgccgcccgtatcgcccgcgagtgtcggctcggcgcccgcatcaacacc
gtcatgcagatggcctttctgcacctcagcgacctgatccccaacggcggcgccctgccg
ctgctgcaggatgccatcgcccgcagctatgccaataaaggacaggagatcgtcgaacgc
aactggcaggcgctgggggcggtcgagggcgcgctgcacgccgttcccctgcgcccggtc
gatgccgagagcccgcgccggccgccgatcgtcgccgaccaggcgccggactttgtcaaa
accgttaccgccgccatgctggccgggctgggcgacagcctgccggtctccgccttcccg
ccggacggcacctggcccgtcggcactacccgctgggagaagcgtaatatcgccgaggcc
atccccatctggcagcccgccctctgcacccagtgtaaccactgcgtcgccgcctgcccc
cacgcggcgatccgcgccaaggtggtcgcgccggcggcgctggagcacgcgccagccacg
ctggagagcctggaggtccgcgcccgcgatctgcgcggcgagcgctatgtgctgcaggtg
gcaccggaagactgcaccggctgcaacctgtgcgtgacggtctgcccggcggcggatcgt
caggaccccagcgtcaaggccatcaatatgcaaccacgtctggcgcacctggcgcgggaa
aaggcgcattacgacgcgtttctggccctgccggagatcgaccgccgtcgcctggagcgc
atcgatatacgcacctcgcagctgatttcgccgctgtttgaatactccggcgcctgctcc
ggctgcggtgaaaccccctatatcaagctgctgacccagctgttcggcgatcgtatgctg
atcgcgaacgccaccggctgctcctccatctatggcggcaacctccccaccagcccctat
accaccgatgcacagggacgggggccggcctgggccaactcgctgtttgaggataacgcc
gagtttggcctcggcttccgcctgagcgcccagcagcaccgccagcgggcgctgcgcctg
ctccatgcgctggccggacagctgccagaggcgctggtcgcggcgctgcagcaggaggag
acgcccaccgagacgcggcgtcagcagatagcggcgctgcgcgcggccctggcgacgctc
gacgatccgcaggcccaggcgctggcgcagacggccgatgccctggtagagcaatccatc
tggctgatcggcggcgatggctgggcctacgatatcggcttcggcgggctggatcacgtg
ctgagcctgagcgaaaacgtcaacgtcctggtcctggatacccagtgctactccaatacc
ggcggacagcagtccaaggcgacgccgctggcagcggtcaccaagtttggcgaacacggt
aagcgcaaagcgcgtaaggatctcggcgtcagcatgatgatgtatggccacgtctacgtc
gcccaaatctcgctgggcgctcagctgaaccagaccgtcaaggcgctgcaggaggccgaa
tcctatccgggcccctcgctggtgatcgcctacagcccctgtgaggagcacggctacgat
ctggccgacagccatgagcagatgaagcgcctgacggccaatggattctggccgctgtac
cgctttgatccgcgccgcggcgccgaggggcagaacgccctggcgctggactcccggccg
cccagcggcgatctggcgcaaacgctgctggccgaacagcggttccgtcggctgaacagc
ctggcgccgcaggaggcgcagacgctataccgcgaggcagaggagaacctgcgtcagcgt
ttcgccctgctcagcctgctggcggggaaaacgccccctgccaccgagtaa

DBGET integrated database retrieval system