KEGG   Edwardsiella tarda EIB202: ETAE_1878Help
Entry
ETAE_1878         CDS       T01121                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:etr03016]
    ETAE_1878
Enzymes [BR:etr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     ETAE_1878
Transfer RNA biogenesis [BR:etr03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    ETAE_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2 PilZ
Motif
Other DBs
NCBI-ProteinID: ACY84715
UniProt: D0Z8E6
Position
1985043..1986914
Genome map
AA seq 623 aa AA seqDB search
MVKGTDKGFGFLEVDAQKSYFIPPPQMKKVMHGDRVRAAVQVDKEREIAEPEELLEPFLT
RFVGRIQKKENDERLSIIPDHSLLKDAIGCRPARGLDRAFRQGDWVLAEMRRHPLKGDRS
FFAEITAFITDGSDHFAPWWVTLTRHDLARSAPQWQAGTLLEEGLAREDLCALPFVTIDS
ASTEDMDDALHVRENADGSLCLTIAIADPTAYVSADSPLDAEARHRAFTTYLPGFNIPML
PRDLSDDLCSLREGQRRPVLACEVTLDADGSLRDDIRFFSGWIESKAKLVYDRVSDWLEG
RGDWQPPSDDIAAQIRLLHRVANARTQWRQQHALVFRDRPDYRFVLDDHGDVTDIVAEPR
RVANRIVEECMITANVCAALVLRERLGFGIYNVHTGFDPALVEQAVSLLNANDVAANAEA
LLTLDGFCTLRRHLDSLPSTFLDSRIRRFQTFAEISTEPGPHFGLGLEAYATWTSPIRKY
GDMVNHRLLKALIAGAPATRPDPAMTLQLAERRRQNRMAERDVGDWLYARFLKDKVNAPT
PFNAEIIDISRGGMRVRLLENGAVAFIPASFIHAVRDEMVCSQENGTLQVKGSVVYRQGD
TVPVTLSEVRLDTRSLIARPFSA
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaagggaaccgacaaaggctttggctttttagaggtcgacgcgcagaagagctat
ttcattccgccgccgcagatgaagaaagtgatgcacggcgaccgcgtccgtgccgccgtt
caggttgataaagagcgcgaaatcgccgagccggaagagctgctggagcctttcctgacc
cgttttgtcgggcgtatccagaaaaaagagaacgacgaacgtctgtccatcatcccggat
cactcgctgttgaaagacgccatcggctgtcgtccggcgcgcgggctggatcgcgccttc
cggcagggagactgggtgctggccgaaatgcgccgccatccgctgaagggcgaccgcagc
ttctttgccgagatcaccgccttcattaccgacggcagcgaccactttgccccctggtgg
gtcaccctgacccgccacgatctggcgcgcagcgcgccgcagtggcaggcgggaaccctg
ctggaagaggggctggcgcgtgaagatctgtgcgcgctgccgtttgtcaccatcgacagc
gccagcaccgaagatatggatgatgcgctgcacgtgcgcgagaacgccgacggcagcctg
tgcctgaccatcgctatcgccgatccgacggcctacgtcagcgccgacagtccgctggac
gccgaggcgcgccatcgcgccttcaccacctatctcccgggctttaacatcccgatgctg
ccgcgcgatctctctgacgacctgtgctcgctgcgcgaagggcagcgccgtccggtgctg
gcctgcgaggtcaccctcgacgccgacggcagcctgcgcgacgacatccgcttcttcagc
ggctggatcgagtccaaggcaaagctggtctacgatcgggtctccgactggctggagggc
cgcggcgactggcagccgccgagcgacgatatcgccgcccagatccgactgctgcaccgc
gtggccaacgcccgcacccagtggcgtcaacagcatgccctggtgttccgcgatcgcccg
gactaccgctttgttctcgacgatcacggcgacgttaccgatatcgtcgcggagccgcgc
cgggtggccaaccgcatcgtagaagagtgcatgatcaccgccaacgtctgcgcggcgctg
gtgctgcgcgaacgcctcgggtttgggatctacaacgtccataccggctttgatccggcg
ctggtggagcaggccgtctcactactgaacgccaacgacgtcgccgccaacgccgaggcg
ctgctgacgctggacggcttctgcaccctgcgccgccatctcgactcgctgccgagcacc
ttcttagatagccgtatccgccgcttccagacctttgccgaaatcagcaccgagccgggg
ccgcactttggcctggggctggaggcctacgccacctggacctcaccgatccgtaagtat
ggcgatatggtcaaccaccgtctgctgaaggcgctgatcgccggagcaccagcgacgcgg
ccggacccggcgatgacgctgcagctggccgagcgccgccgtcagaaccggatggcggag
cgcgacgtcggcgactggctgtacgcccgcttcctgaaggacaaggtcaacgccccgacc
ccgttcaacgccgagatcatcgatatctcgcgcggcggcatgcgcgtccgcctgctggag
aacggcgcggtggcctttattccggcctccttcatccatgccgtgcgcgacgagatggta
tgcagccaggagaacggcacccttcaggtgaaaggcagcgtcgtctaccgccagggcgat
accgttccggtgaccctgagcgaggtgcgcctcgatacccgcagcctgatcgctcgcccc
ttcagcgcctga

DBGET integrated database retrieval system