KEGG   Edwardsiella tarda EIB202: ETAE_2015Help
Entry
ETAE_2015         CDS       T01121                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00071  Fatty acid degradation
etr00072  Synthesis and degradation of ketone bodies
etr00280  Valine, leucine and isoleucine degradation
etr00310  Lysine degradation
etr00380  Tryptophan metabolism
etr00620  Pyruvate metabolism
etr00630  Glyoxylate and dicarboxylate metabolism
etr00640  Propanoate metabolism
etr00650  Butanoate metabolism
etr00900  Terpenoid backbone biosynthesis
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01120  Microbial metabolism in diverse environments
etr01130  Biosynthesis of antibiotics
etr01200  Carbon metabolism
etr01212  Fatty acid metabolism
etr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAE_2015
   00630 Glyoxylate and dicarboxylate metabolism
    ETAE_2015
   00640 Propanoate metabolism
    ETAE_2015
   00650 Butanoate metabolism
    ETAE_2015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ETAE_2015
   00072 Synthesis and degradation of ketone bodies
    ETAE_2015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ETAE_2015
   00310 Lysine degradation
    ETAE_2015
   00380 Tryptophan metabolism
    ETAE_2015
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETAE_2015
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ETAE_2015
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAE_2015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etr04147]
    ETAE_2015
Enzymes [BR:etr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ETAE_2015
Exosome [BR:etr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAE_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACY84852
UniProt: D0Z8V3
Position
2123998..2125182
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGALSGVSAIDLGATVIRAALERARLDPQRVDEVIMGNVLQAG
LGQNPARQALLRAGLSEAVCGFTVNKVCGSGLKSVALAAQAIQAGQAQALVAGGMENMSQ
APYLLNAKARWGYRLGDGTLTDVILQDGLLCATHGYPMGITAENIAREYGISREMQDALA
LHSQQKAASALQRGAFRAEIVPVSVTSRKKTTLVERDEFPKADTTAEGLAALRPAFDQAG
SVTAGNASGINDGAAALVVMEESAARAAGLTPLARIKGYASAGVAPALMGMGPVPAAQKA
LRQCGLQMTDIDLIEANEAFAAQFLAVGRTLGLEAEKVNVNGGAIALGHPIGASGARILV
TLLHALAARDKTLGLATLCIGGGQGIALIVERIG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcggtacgcaccgccatcggcagcttcaacggcgcc
ctgtccggcgtcagcgccatcgatctgggcgccacggtcatcagggccgccctggaacgc
gcccgcctcgacccgcagcgggtggatgaggtgatcatgggcaacgtgctgcaggccggc
ctggggcaaaacccggcgcgccaggcgctgctgcgggccggcctcagcgaggcggtctgc
ggttttaccgtcaacaaggtctgcggatcggggcttaagagcgtggcgctggccgcccag
gccattcaggcggggcaggcgcaggcgctggtcgccggcggtatggaaaacatgagtcag
gcgccgtacctgctgaatgcaaaggcgcgctggggctaccgcctgggcgacggcacgctg
accgacgttatcctgcaggatggcctgctgtgcgccacccacggctacccgatggggatc
accgccgaaaacatcgcccgcgaatacggcatcagccgtgagatgcaggatgcgctggcc
ctgcactcccagcaaaaggcggccagcgccctccagcgcggcgcgtttcgggccgagatc
gtcccggtcagcgtgacatcgcggaaaaaaaccaccctcgttgagcgcgacgaattcccc
aaagccgacaccacggcggaagggctcgccgccctgcgcccggcgttcgatcaggccggc
agcgtcaccgccggcaacgcctcggggatcaacgacggcgcggcggcgctggtggtgatg
gaggaaagcgccgcccgggcggcggggctgacgccgctggcgcggattaagggctatgcc
agcgccggcgtcgcaccggcgctgatggggatggggccggtgcccgccgcccagaaggcg
ctgcgccagtgcgggctgcagatgaccgatatcgatctgattgaggccaacgaagccttt
gccgcgcagttcctggccgtcggcaggacgctggggctggaggctgaaaaggtcaacgtc
aacggcggcgccatcgcgctgggccaccccatcggcgccagcggcgcccggatcctggtc
accctgctgcacgcgctcgccgcccgggacaaaaccctggggctggcgacgctgtgcatc
ggcggcggccaggggatcgccctgatcgtggagaggatcggctaa

DBGET integrated database retrieval system