KEGG   Edwardsiella tarda EIB202: ETAE_2429
Entry
ETAE_2429         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:etr02044]
    ETAE_2429
Secretion system [BR:etr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ETAE_2429
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACY85264
UniProt: D0ZB30
Position
2555437..2555901
AA seq 154 aa
MQITYDVEIGDAQEMKELPFVMGVLGDYSGQPATPLPKLKERKFVSIDRDNFNDVIKGVH
PHLSFRTENTLSGDDSQLSVDLHFQSMADFTPERVAAQVEPLRKLMDIRSRLSDLKNKMY
SNERLGEVLQGIIEDTEKLQSLGKETGFGEEKQP
NT seq 465 nt   +upstreamnt  +downstreamnt
gtgcagattacctatgatgttgaaattggcgatgcgcaggaaatgaaggagctgccattt
gttatgggagtgctcggtgactattcagggcagccggcgactccgcttcccaagctgaaa
gagcgcaaattcgtttcgattgatcgcgacaacttcaacgatgttatcaaaggggtgcat
ccccatctgtcattccgcaccgagaataccctgagcggagatgacagccaactgtcggtg
gatctgcattttcagagcatggcggatttcaccccagagcgggtcgcggcgcaggttgag
ccgctgcgcaagctgatggatatccgcagccgcctctctgacctgaaaaacaagatgtac
agcaatgaacgcctgggtgaggtattgcagggcatcattgaggataccgaaaagctgcag
agtctgggtaaagagaccggctttggcgaggagaagcagccatga

DBGET integrated database retrieval system