KEGG   Edwardsiella tarda EIB202: ETAE_2431
Entry
ETAE_2431         CDS       T01121                                 

Gene name
evpC
Definition
(GenBank) type VI secretion system protein EvpC
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:etr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ETAE_2431 (evpC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:etr02044]
    ETAE_2431 (evpC)
Secretion system [BR:etr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ETAE_2431 (evpC)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACY85266
UniProt: D0ZB32
Structure
PDB: 
3EAA

Position
2557455..2557946
AA seq 163 aa
MAFDTYIKLDKVDGESTDDKHKKWIEVLGFAWGAGNECTMESGTQGLNTGKAMMSVLRVT
KWMDCASVKLASAAVQGQNFPTLELEICTQAGDKFAFCIYKFTHVAVSSYQCSGATGGSD
RPQETIDFAYKEVTWEYVPQDQNGKAGGKIGPEGWSLITNKKK
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcttttgatacttatatcaaactggataaggttgatggggaatccaccgacgataag
cacaaaaaatggattgaagtgctgggttttgcctggggagccggcaatgaatgcacgatg
gagagcggcacccaggggctgaataccggtaaggcgatgatgtcggtgctgcgtgtcacc
aaatggatggactgcgccagtgtcaagctggcctccgccgccgtgcaggggcagaacttt
cccacgctggagctggagatttgcacccaggcgggcgataagttcgccttctgcatctac
aaatttacgcatgtcgccgtctccagctatcaatgctcaggggccacgggcggcagcgat
cgcccgcaggaaaccattgatttcgcttataaagaagtgacctgggaatacgttccccag
gatcagaacggcaaggcgggcggcaaaattggtcctgagggctggagcctgattaccaac
aagaaaaagtaa

DBGET integrated database retrieval system