KEGG   Edwardsiella tarda EIB202: ETAE_2437
Entry
ETAE_2437         CDS       T01121                                 

Gene name
evpI
Definition
(GenBank) type VI secretion system protein EvpI
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:etr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ETAE_2437 (evpI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:etr02044]
    ETAE_2437 (evpI)
Secretion system [BR:etr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ETAE_2437 (evpI)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: ACY85272
UniProt: D0ZB38
Position
2565397..2567316
AA seq 639 aa
MVQCRGEEAIADLYRFELELFSTDPALAWQSLVGQAAALRLALPNGQTRYWHGVIGRAAY
RGAEQHGFAYYAELVPRLAWLQHAQECQIFQEKTVPQIIEAVLKARGISDFRLSLSQRYA
PREYCVQYRESDLSFISRLMEEEGIFYWFEHSESRHVLVLADGNAAVQPCKVRSDIVYRP
KHRSESGDDIQWWMPSLAVVPANVFLNAYTFEQPTAHLLTSSASVAKQGKLSDVAVYDFT
DDYTQTREGERRAKLKMEGLEAMQARIEGGGRCRTLAPGYGFSLQKHFRKDCNGDYLLLS
VRHEIVNNLPWQEQEVNYQNHFICLPKSLPYRTLSQTPRPVIHGVQTAVVTGPQGEEIHT
DRHGRVKVHFHWDRLGTQDDKSSCWIRVAQGWAGLGWGGMQLPRVGQEVIVDFVDGNPDA
PLITGRVYNAHQTPPFKLPDNKTQSGIQTRSTPNGNPEHFSLLRFEDKMGAEEVFMQAER
DFRRRVKHDDELTVEHDRRVTIKNDCAETVSEGNYLQSITKGKHTRVIEGDALTEVKSGN
STLQVNKGDHATTASAGSLHLKAGTAITLSVGSNRIVIDSGGVLIEGMNITVKGKQSIAL
SGLSVAITGTQSASLSSSAEAEVSSSVMTSIKGGIVKIN
NT seq 1920 nt   +upstreamnt  +downstreamnt
gtggtgcagtgccggggcgaagaggcgatcgccgatctctaccgctttgagctggagctg
ttctccacggaccccgcgctggcgtggcaatcgctggtcgggcaggccgccgcgctgcgg
ctggccttgccgaatggccagacccgctactggcatggcgtgatcggccgggccgcctac
cggggcgccgagcaacacggatttgcctattatgccgagctggtaccgcgcctggcctgg
ctgcagcacgcccaggagtgtcagatcttccaggagaagacggtcccgcagattattgaa
gcggtgcttaaggcgcggggcatcagcgattttcgcctctcgctgtcgcagcgctacgcc
ccccgggaatactgcgtacagtatcgcgaatcggacctcagcttcatcagccgactgatg
gaggaagagggcattttctactggttcgaacacagcgaaagccgccatgtgctggtattg
gccgatggcaatgccgcggtccaaccctgcaaggtgcgctcagacatcgtctatcgacct
aagcataggagcgaatccggcgatgatatccagtggtggatgccctccctcgcggtcgtg
ccggccaacgtcttcctgaatgcctatacctttgagcagccgaccgcccatttgctgacc
tccagcgcctccgtggccaagcagggcaaattgagcgacgtggcggtctacgatttcacc
gatgactatacgcagacccgggagggcgaacgccgcgccaagctgaagatggaggggcta
gaggccatgcaggcccggatagagggcggcggacgctgccgcacgctggcgccgggctat
gggttcagcctgcaaaaacatttccgcaaagactgtaacggtgactatctgctgctaagc
gtacggcacgagatcgtcaacaacctgccgtggcaggagcaagaggtgaactaccagaac
cactttatctgtctccccaaatccctgccctaccgcaccctaagccaaacgccccgcccg
gtgatccatggcgtacagactgccgtggtcaccggtccgcagggcgaggagatccatacc
gatcggcatggccgggttaaggttcattttcactgggatcgcctgggaacgcaggatgat
aaaagctcctgctggatccgggtggcgcagggctgggccgggctgggctggggggggatg
cagctgccccgcgtagggcaggaggtgatcgtggattttgtcgatggcaatccggacgcc
cccctgatcaccggccgggtctataacgcccaccagacgccccccttcaagctgcctgac
aataagacccaaagcggtattcagacccgcagcacccccaatggcaatccggagcacttc
agcctgctgcgcttcgaggacaagatgggggcggaagaggtgttcatgcaggcggagcgg
gattttcgccgccgggtgaaacacgatgacgaactgacggtcgagcacgaccgccgggtg
accatcaagaatgactgcgccgagacggtctccgaggggaactacctgcagagcatcacc
aagggcaagcatacccgggtgatcgagggcgatgccctcacggaggtgaagtcaggcaac
agtacgctgcaggtgaacaagggggatcacgccaccaccgcctcggcgggcagcctccat
ctgaaggcaggaaccgcgataaccctgagcgtgggcagcaatcgtatcgtcattgacagc
ggcggcgtgctcatcgagggcatgaatatcacggtgaaggggaaacagtccattgcgcta
tccggcctcagcgtcgcgataacgggcacccaatcggccagcctgagcagttcggcagag
gcggaggtctcctcgtccgtgatgacctccatcaagggcggtattgtcaagatcaactga

DBGET integrated database retrieval system