KEGG   Edwardsiella tarda EIB202: ETAE_3296Help
Entry
ETAE_3296         CDS       T01121                                 

Gene name
sgaU
Definition
(GenBank) L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00040  Pentose and glucuronate interconversions
etr00053  Ascorbate and aldarate metabolism
etr01100  Metabolic pathways
etr01120  Microbial metabolism in diverse environments
Module
etr_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETAE_3296 (sgaU)
   00053 Ascorbate and aldarate metabolism
    ETAE_3296 (sgaU)
Enzymes [BR:etr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     ETAE_3296 (sgaU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-ProteinID: ACY86127
UniProt: D0ZG29
Position
3466447..3467319
Genome map
AA seq 290 aa AA seqDB search
MLHSTVPLGIYEKALPAGEDWPRRLTQAAQLGFDFVEMSIDESDRRLARLTWSRQQRLDL
LAAMAHSGVRIPSLCLSAHRRFPLGSEDPAVRRQALRLLAHAITLAQDLGIRVIQLAGYD
VYYQQGNALTRRLFREGLSQAVTMASRAQVTLAMETMDTPLLNSVSKALGYCRYLRSPWF
QVYPDIGNLSAWDNDVELELVAGIDRIVAVHVKDTRPGQFRDVPFGSGVVDFETCFRTLD
RHGYRGPYLIEMWSESAPDPLQAVREAREWIIERMRRAGLAVTQEASWNG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctgcattccacggtgccgctgggcatctatgaaaaggcgctgcccgccggcgaagac
tggccacgacgcctgacgcaggccgcgcagctcgggttcgacttcgtcgaaatgtctatc
gatgaaagcgatcgccgcctggcccgactgacctggtcgcgccagcagcgtctggatctg
ctggcggcaatggcgcacagcggcgtgcgtattccctccctgtgcctcagcgcccaccgc
cggtttccgctgggcagcgaggatccggcggtcaggcgtcaggcgctgcggctgctggcc
cacgcgattaccctcgcccaggatctgggtatccgggttattcagctggcgggatacgac
gtctactatcagcagggcaatgccctgacccgccgactgttccgcgaggggctgagccaa
gccgtcaccatggccagccgggcgcaggtcacgctggccatggaaaccatggacacgccg
ctgctcaactccgttagcaaagcgctcggctactgccgctatctgcgcagcccctggttc
caggtctacccggatatcggcaacctttcggcctgggataatgacgtcgagctggagctg
gtggccggcatcgaccgcatcgtcgccgtgcatgtcaaagatacccggccgggccagttt
cgggatgtgcccttcggcagcggtgtggtcgactttgagacctgcttccgcacgctggat
cgccatggctaccgcggtccctacctgatcgagatgtggagcgaaagcgccccggacccg
ctgcaggcggtgcgcgaggcgcgtgagtggatcattgaacggatgcgacgcgccggactg
gcggtgacgcaggaggcctcatggaacggctga

DBGET integrated database retrieval system