KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0221
Entry
ECSP_0221         CDS       T00949                                 

Definition
(GenBank) predicted protein
  KO
K06887  uncharacterized protein
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Brite
KEGG Orthology (KO) [BR:etw00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECSP_0221
SSDB
Motif
Pfam: T6SS_HCP Tudor_FRX1
Other DBs
NCBI-ProteinID: ACT70109
Position
complement(243517..243996)
AA seq 159 aa
MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFMHGLNRDQNVNHHHLT
IKKPIDKASPLLGKAICDNELLTCDFSFYRTNKFGINELFYKIKLTGAKISDIHVSISHI
VVDNSVQPEESVSFSYESIIWEHCSAGTSAYSLWEDRLF
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcgaatttaatttatttaacactaaatggtgataatcaagggctcatttcaagtggt
tgttcatcacaaccatccattggaaataaagctcaaacagcacacattgatcaaattatg
atttatgaattcatgcatggattaaatcgagatcaaaacgtcaaccatcatcatttgaca
ataaaaaaacctatagataaagcatcacccttattaggcaaagcaatttgcgacaatgaa
ttattgacatgtgatttttccttttatcgtacaaataaatttggaattaatgaactgttc
tataaaatcaaattaactggagcaaagataagcgacattcatgtctctatatcacatatt
gttgttgataacagcgttcaacccgaagagtcagtttctttcagttatgagtcaattata
tgggagcattgttccgctggcactagtgcatacagtttatgggaagatcgtcttttttaa

DBGET integrated database retrieval system