KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0222Help
Entry
ECSP_0222         CDS       T00949                                 

Definition
(GenBank) predicted protein
  KO
K11911  type VI secretion system protein VasL
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Brite
KEGG Orthology (KO) [BR:etw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:etw02044]
    ECSP_0222
Secretion system [BR:etw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECSP_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL ImpA_N
Motif
Other DBs
NCBI-ProteinID: ACT70110
Position
complement(243962..245461)
Genome map
AA seq 499 aa AA seqDB search
MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSDPRGLPEFSAIREEIN
KASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMV
SHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQ
VELKRVPRVENLLYFMQNTRKRLEPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPP
LPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLL
QVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQ
ASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGL
GQETPVESLLTQYQDARAQKQNTDALEKQINERLEGVLSRWLLLKNNTIPTIKKALNFNN
IHEYKGVLNGEFNLFNTKW
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcataccgacacggaagataacccgttcagcggtgggttgttcagccagtttggtc
tgtcagacacactgtactgaggaggcagggatgaatagtaacgtactgacacaaactatc
gttaccggcagtgacccgcgcgggctgccggaattcagcgccatccgcgaggaaataaac
aaagccagccacccgtcacagcctgagctgaactggaaactggtggagtcgctggcgctg
gcgatttttaaagccaacggtgtggatttacacaccgccacctactatacgcttgcccgg
acacggacacagggactggcgggattctgcgaaggtgcggaactgctggcggcaatggta
agccacgactgggataagttctggccgcagggcggcccggcgcgtactgaaatgctggac
tggtttaactcccgaaccggcaatattctgcgtcagcaaatctcctttgcggaatccgac
ctaccactgatctaccgcacagagcgggcattgcagcttatctgcgataagctccagcag
gtggaactgaagcgcgttccgcgcgtggagaatctgctctattttatgcagaacacgcgt
aaacggcttgaaccccagctgaagagtaacactgagaacgccgcacagaccacggtcaga
acgctgatttatgccccggaaacacaggcatcttccacaccagaagcggtagtgcctccc
ctgcccggcctgcctgagatgaaagtggaagtgcgcagtctgacagagaatcccccacag
gccagtgtgataaagcaaggcagtacggtaagagggtttatcgcagggatcgcctgttca
gtggctgtcgcctcagcattgtggtggtggcaggtctatccggtgcagcagcaactgtta
caggttaacgacaccgctcagggcgcagcaacggtgtggatggcctcacctgaactcgaa
aactatgagcgcaggctgcaacaacttcttgatacctccccggtacagccgctggaaacc
gggatgcagatgatgcgtgttgccgacagtcgctggccggaaagcctgcaacagcaacag
gcctcgacacaatggaatgaggcactcaaaacccgcgcacagagtagcccgcagttgcgt
ggctggttgcagacccgccaggacttacatgcttttgcagatctagtgatgcagcgcgag
aaagagggactaaccctttcctatatcaaaaatgtcatctggcaggcggagcggggactg
gggcaggaaacacccgttgagtctctgttgacgcagtaccaggatgcccgtgcgcagaag
cagaatacagatgcgctggaaaaacaaattaatgagcgactcgaaggcgtgttaagccgc
tggctgctgctgaagaataatacgataccgacgataaaaaaagcattgaatttcaataac
attcatgaatacaaaggagttttaaatggcgaatttaatttatttaacactaaatggtga

DBGET integrated database retrieval system