KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0224Help
Entry
ECSP_0224         CDS       T00949                                 

Definition
(GenBank) ImpA domain protein
  KO
K11910  type VI secretion system protein VasJ
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Brite
KEGG Orthology (KO) [BR:etw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:etw02044]
    ECSP_0224
Secretion system [BR:etw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECSP_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N FAM86
Motif
Other DBs
NCBI-ProteinID: ACT70112
Position
complement(248953..250365)
Genome map
AA seq 470 aa AA seqDB search
MAMDLRDPNVWISHLLENLPEEKLASALKDDNPDWEYIDGEIVKLGSLAHAQLDIPELQR
RGLQLLASESKDFRLLAHLLRTLQHAGDPLLALHLLTLYVEHYWTVAAPQNMAHKKRFAS
QIIKRFETGIEGFSQNAATTQRDTLLGELAKLAQCWQSHNVPELAQATDDLFALYQRTFN
RAAPAPVPTPAASGSSPQTTVTSESGVTQPSAPAPQIAIDSHDDKAWRDTLLKVAAILCE
RQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAAVSADMVADYQSRLASADMALWQQV
EKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRFLERLPQLTGLLFNDRTPFLS
EQTKQWLAASPDGKVAPVAQIGEESQAARACFAGQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLIQLAQQQYRMLLMIGSQMMVSDWEPSLLTQLEQKFTAEQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggacttacgcgatccgaatgtctggatatcgcacctgctggaaaacctgccg
gaagaaaaactggcatcggcgctgaaagatgacaacccggactgggagtatatcgacggc
gaaatcgtcaagctggggtctctggcccacgctcagcttgatattcccgaactacaacgc
agggggctacagcttctggcttctgaaagcaaagacttcaggctactggcacacctgctc
agaaccctgcaacatgccggtgatccactgctggcactgcacctgctaacgctatacgtg
gaacattactggactgtggccgcgccgcagaatatggcgcataaaaaacgctttgccagc
cagatcattaaacgttttgaaacgggtattgaaggcttttcacaaaacgctgccacaacg
cagcgcgatactctgctgggtgagctggcgaaactggcgcagtgctggcagtcacataac
gtcccggaactggcacaggctaccgatgatctttttgccctgtaccagcgtacgtttaat
cgtgcggctcctgctccggtccccactccggcggcctccggtagttcaccacaaaccacc
gtcacgtctgaaagcggcgtgacgcaacccagtgctccggctccccaaatcgccatcgac
agtcacgacgacaaagcctggcgcgacacgctgttaaaagtggcggctattttatgtgaa
cgccagccggactcgccgcagggctatcgcctgcgccgccatgccctgtggcaatccatc
accagtacaccccaggcggaaagcgatggacgtaccccactggctgcggtctctgccgat
atggtggcggattaccagtcccggcttgccagcgcggatatggcgctgtggcaacaggtt
gagaaaagcgtattgctggctccttactggctggacggtcactgtctttctgcacagacg
gcactgcgtctgggttacaaacaggtggcagacaccatccgcgatgaggtcatccgcttc
cttgagcgtctgccccagcttaccgggctgctgtttaatgaccgcacaccgtttctcagt
gagcagacgaaacaatggctggctgcttcgcccgacggcaaagttgcaccggttgcgcaa
atcggtgaggaatcgcaggcagccagagcctgttttgctgggcagggtctggaggcggcg
ctgcgatatctggacatgctacccgaaggcgatccccgcgatcagtttcaccgccagtac
cttgccgcacagttgacggaggaggcggggctgatacagcttgcgcagcaacagtaccgg
atgttgttgatgatagggagtcagatgatggtgtctgactgggagccatcattacttacg
cagcttgaacaaaaattcacggcagaacaataa

DBGET integrated database retrieval system