KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0229
Entry
ECSP_0229         CDS       T00949                                 

Definition
(GenBank) predicted protein
  KO
K11906  type VI secretion system protein VasD
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:etw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECSP_0229
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:etw02044]
    ECSP_0229
Secretion system [BR:etw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECSP_0229
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ACT70117
Position
complement(255996..256520)
AA seq 174 aa
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNA
EGESAAVDVQLVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPI
KLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaacaggaaggcgtttctggcctgcgtgctgatgtgcgtcatattaaccggctgcgaa
acggcgaaaaaaatcagcgaggtgatcaaaaacccggatatccaggtcgggagcctgaag
gagcaaccttcggaaataaccgtcaccctgctgactgaaccggacaccaataccaatgcg
gagggtgaatcagccgccgtggatgtgcaactggtgtacctgactgacgactcaaaattg
caggcagccgactatgaccagatagccagtacgccgctaccggatgtgctgggtaaaaac
tatatcgaccaccaggatttcaacctgttgccggacaccatcaaaaccctgccgccgata
aagctggatgagaaaacgcagtttattggtgtcgtggcctatttctccgatgaccaggcc
actgaatggaaacaaatcgagacggtggaaggaaccggccaccattaccgcctgctggtg
catgtacgtcaaagcagcatcgaaatgaaaaaagaggatgaataa

DBGET integrated database retrieval system