KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0230
Entry
ECSP_0230         CDS       T00949                                 

Definition
(GenBank) predicted protein
  KO
K11894  type VI secretion system protein ImpI
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Brite
KEGG Orthology (KO) [BR:etw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:etw02044]
    ECSP_0230
Secretion system [BR:etw02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   ECSP_0230
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: ACT70118
Position
complement(256517..257818)
AA seq 433 aa
MIITEQNMPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSVQDRQQSIP
AQAFTVILHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDI
PHYDEEMATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLADTVVNGFSADPLQALQS
ESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDHNDDISAAEMAQR
HLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGLLDLQQQRNSLSDKHLRPLE
DNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRVLLD
AFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVY
DRVLREKQREPEA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgataatcacggagcagaatatgccggaagagaaactacagacgctttcattgcaggtc
attaacggcagtgagctggaaagcgggcgggcggcgcgctgtctgttcacacagcaggga
aatgtcggccatgcccccgaatgccactggtcggtacaggatcgtcagcagagcattccg
gcccaggcttttaccgttatcctgcacgatggcacattttgtctacgcccgcagacggca
caactgtggctgaatcaggcaaaagtcacagcaacatcagacctgatacagttgcgccag
ggcgatgagatccagatcggacggctgatggtgagggttcatctgaaccggggagatatt
ccccattacgatgaggaaatggccactcccgaaaccatcgttaccaatcgcgatatgctc
acggataccctgctatcaacggagggtgcgccacactatccgggaatgactcaccggcac
cagcttgcagacaccgtggtaaatggtttttctgccgatccactccaggcacttcagtcc
gaaagcctgattaccacgggcgatccgctttcaggcattgcggctgtccggccatcggca
ccgctgtccgatccggcaagtaatggggggatcaatactccgtttatggatctgccgccc
atttatgccagccctggcgatcataatgatgacatctctgcggcagaaatggcgcaacgc
caccttgcggtcacccccttactgcgcggtcttggcggctcgcttaccgtgagcaattcc
gacgatgcggatgattttctggaggaggccggacgaacgttacaggccgcaataaaaggt
ctgctcgatttgcagcagcagcgtaacagcctctcagacaaacatttgcgcccgctggaa
gataacccgctgcgcctgaacatggattacgccaccgcgctcgacgtgatgtttgccgaa
ggtaaaagcccggtacatctggcggctcccgccgccgtcagtgaaagcctgcgcaatgtc
cgccaccacgaagaagctaaccgggcggcgattgtggagtcgcttcgtgtcctgctggat
gctttctcaccacaaaatctgctgcgccgctttgtgcagtaccgccgcagccatgaactg
cgccagccgctggatgatgccggagcatggcaaatgtacagccattattacgaagaactg
gcctccgatcgccagcaggggtttgagatgctgtttaacgaggtctacgcccaggtctat
gaccgggtgcttcgtgaaaaacagcgggagccggaagcatga

DBGET integrated database retrieval system