KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0238
Entry
ECSP_0238         CDS       T00949                                 

Definition
(GenBank) predicted protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:etw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECSP_0238
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:etw02044]
    ECSP_0238
Secretion system [BR:etw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECSP_0238
SSDB
Motif
Pfam: T6SS_HCP SBBP
Other DBs
NCBI-ProteinID: ACT70126
Position
264124..264642
AA seq 172 aa
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPA
GQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTI
VDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacaccgtgttatatctccatcactggtcagacccagggaaatattactgcaggt
gcatttaccgctgattctgtcggcaacatctatgtgcaggggcacgaagacgagatgctg
gtgcaggaattcctgcataacgttactgtcccgaccgatcctcagtccggtcagcctgcg
ggtcagcgtgctcacaagcctttcatttttaccgtggcgctgaacaaagcggttccgctg
atgtacaacgcactggcctccggcgaaatgctgccaaccactgaacttcactggtggcgt
acctctgtggaaggcaaacaggagcattatttcactacccgcctgactgattcgacgatt
gtcgatatgaaactgcatatgccgcattgccaggacccggcgaaacgcgagttcacccag
ttgctcgaagtttcactggcctaccgcaaaattgaatgggaacacgtcaaatctggcacc
tccggtgccgacgactggcgcgcaccgctggaagcataa

DBGET integrated database retrieval system