KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0241Help
Entry
ECSP_0241         CDS       T00949                                 

Definition
(GenBank) predicted protein
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHS_repeat RHS UPF0257
Motif
Other DBs
NCBI-ProteinID: ACT70129
Position
267069..271301
Genome map
AA seq 1410 aa AA seqDB search
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITYANPVNPVLGAKVLPG
ETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDNGGRS
IHFEPLFPGEISYSRSESFWLARGGVAEQHSSQPLSALWQVLPEDVRLSPHMYLATNSLQ
GPWWILNWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAFHRAAEGDVAGAVTGVTDG
AGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLVFPDTLPAGTEYGADNGIRL
EAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGTQVRGFAYDAEHAGRMVAHHY
AGRPESRYRYDDTGRVTELVNPEGLDYRFEYGQDRVTITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGYNSQ
RQVTSVTYPDGLRSSREYDEKGRLAAETSRSGETTRYSYDDPASELPTGIQDATGSTKQM
AWSRYGQLLTFTDCSGYTTRYEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRE
TRYEYSAAGDLTAIVAPDGSRSEIQYDAWGKAVSTTQGGLTRSMGYDAAGRITVLTNENG
SQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKLTQSEDEGLVTLWHYDASDRITHRTVN
GDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVENPETGEMLWEHET
GHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVEYMRDRLHRETARSFGGE
AYELATAWNTSGQLRSRHLNLPQLDRDYDWNDNGQLIRISGPQESREYRYSDTGRLTGVH
TTAANLDIDIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYIYRYDEYGRLAEKT
DRIPEGVIRMHDERTHHYHYDSQHRLVFHTRIQHGEPQVESRYLYDPLGRRTGKRVWRRE
RDLTGWMSLSRKPEETWYGWDGDRLTTVQTQQTRIQTVYQPGSFTPLLRIETENGEQAKA
RHRSLAEVLQEDTGVTLPAELAVMLGRLERELRQGSVSEESQQWLAQCGLTAEQMAAQLE
AEYIPERKLHLYHCDHRGLPQALISPEGETAWQGEYDEWGNLLGETSAQHLQQPYRLPGQ
QYDEESGLYYNRHRYYDPLQGRYITQDPIDIKGGWNLYSYALNPVSWIDPLGLTQCDSEG
CNNDILFTGGSGPDNKILNELGPRDGIDGLGSQNMKMYSGLLGGDILKPGILGGLTLGSV
TQRPSRTAEEEVQAQIEYLAYKKRCEQKPDSNLSRCAAAIFQKSRKEDCLRMRQEWDDKW
WPGKHADEIKNVKASLKNTLIDVKKKMHAN
NT seq 4233 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaaaaccggcggcgcggcagggtgacatgacccgcaagggactggatattgtg
cagggttcagcaggggtgctgataggtgcgccgacgggcgtggcctgctcggtgtgtccg
ggagggattacctatgctaacccggtgaacccggtgctgggtgcgaaggtgctgccgggc
gagacggaccttgcgctgcccggcccgctgccgtttattctttcccgcgcctacagcagc
taccggaccagaacacccgcgccggtgggggtgtttggtcccggctggaaagcgcccttc
gatatccgcttacagatacgcgatgaaggcctgatactcaacgacaacggcggcaggagc
attcactttgagccgctgtttcccggcgagataagctacagccgcagcgagtcgttctgg
ctggcgcggggcggggtggcggagcagcacagttcgcagccgctaagcgcgctctggcag
gtgctgccggaagatgttcgcctgagtccgcatatgtacctggcgacaaacagccttcag
gggccgtggtggatactcaactggccggagcgggtgccgggggcggacgaggtgctgccg
ccggagccgcccgcataccgggtgctgacgggcgtggtggatggcttcgggcggacgctg
gcctttcaccgggcggcggagggtgatgtggcgggcgcggtgacgggggtgacggacggc
gcgggccgccgttttcacctggtgctgaccacacaggcacagcgggcggaagtattccgt
aaacagcgcgccacgtctttatcttcccctgccggtccccgttctgcttcctcttctctg
gttttccccgacacgctgcccgccggtacagaatacggtgccgataacggtatccggctg
gaggcggtatggctgacacacgacccggcatacccggatgaactgcccgccgcgccgctg
gcgcgctacacgtacacggccagcggagaactgcgggcggtgtatgaccgcagcgggacg
caggtgcgcgggtttgcttatgatgcggagcacgccgggcggatggtggcgcaccattat
gcgggtaggccggagagccgctaccggtatgatgataccggccgggtgacggagctggtc
aacccggaggggctggactaccgctttgagtacgggcaggaccgtgtgaccatcacggac
agcctgaaccggcgggaggtgctgtacacggaaggcgagggtggcctgaaacgtgttgtg
aagaaggaacatgcggacgggagcatcacccgcagcgagtatgatgaggcggggaggctg
aaggcacagacggatgcggcgggacggcggacggagtacagcctgcatatggcgtcgggt
gcggtgacagcggtgacggggccggacggcaggacggtgcggtatggctataacagccag
cggcaggtgacgtcagtgacgtacccggacgggctgcgcagcagccgggagtatgatgag
aagggaaggctggcggcggagacctcgcgcagcggagagacgacgcggtacagctatgat
gacccggcgagtgagctgccgacagggatacaggacgcgacgggcagtacaaaacagatg
gcatggagccgttacggtcagctgctgacctttacggactgctcggggtacacgacgcgg
tatgagtatgaccggtacggtcaacaaatcgccgttcaccgggaagaaggcatcagcact
tacagcagttataacccgcgtggccaactggtcagtcagaaggatgcgcaggggcgtgaa
acccgttatgagtacagcgccgcaggcgacctcaccgctatcgttgccccggacggcagc
cgcagtgagatacagtatgatgcgtggggaaaggccgtcagcaccacgcagggcggtctg
acgcgcagcatggggtatgacgctgccgggcgcatcaccgtgctgaccaacgagaacggc
agccagtccacgttccggtatgacccggtggacaggctgactgaacagcgcggttttgac
ggccggacgcaacgttaccactatgacctgaccggaaaactcacgcagagtgaagacgag
gggcttgtcaccctctggcactacgatgcgtcggaccgcatcacgcaccggacggtgaac
ggcgacccggcagagcagtggcagtatgatgagcacgggtggctaaccaccctcagccat
accagtgaaggccaccgggtgtcggtccactacggctatgacgataaaggccgcctgacg
ggtgaacggcagacggtggagaacccggagacgggggagatgctgtgggagcatgagacg
gggcacgcgtacagcgaacaggggctggcgacccgtcaggagccggacggtctgccgccg
gtagagtggctgacgtatggcagcggttatcttgcggggatgaagctgggcggaacgcca
ctggtcgagtacatgcgggaccggctgcaccgtgagacggcccgcagcttcggcggggag
gcatatgaacttgccaccgcctggaataccagcggccagctccggagcaggcacctgaac
cttccgcagcttgaccgtgactacgactggaacgacaacggacagctaatccgcatcagc
ggcccgcaggagagccgggagtaccgttacagtgacacgggaaggctgacgggcgtccac
accacggcagcgaacctggatatcgatatcccgtatgcaacggacccggcaggaaaccgg
ctgccggacccggaactgcatccggacagcacgctcacggcgtggccggataaccgcatc
gcggaagatgcgcactatatctatcgctacgatgaatacggcaggctggcggagaagacg
gaccgtatcccggaaggggttatccggatgcacgacgagcgcacccaccactatcactac
gacagccagcaccgcctggtgttccacacgcggatacagcacggcgaaccacaggtggag
agccggtacctctatgacccgctgggccgccggacgggaaaacgggtgtggcggcgggag
cgtgacctgacggggtggatgtcgctgtcgcgtaaaccggaggagacctggtacgggtgg
gacggtgacaggctgaccactgtacagacccaacagacaagaatccagacggtataccag
ccgggaagcttcacgccgctcctgagaatcgaaacagagaatggtgaacaggcgaaggcg
cggcaccgtagcctggcggaggtgttgcaggaggacacgggtgtgacgctaccggcggag
ctggcggtgatgctggggaggctggagcgggaactgcggcagggcagcgtgagtgaagaa
agccagcagtggcttgcgcagtgcgggctgacggcggaacagatggccgcgcagctggag
gcggaatatatcccggagcggaaacttcatctttaccactgcgaccaccggggactgccg
caggcgctcatcagcccggaaggggaaacggcgtggcagggggagtatgacgagtgggga
aacctgctgggcgaaaccagcgcgcagcacctgcaacagccgtaccgtctgccgggacag
cagtatgatgaggagtcggggctgtattacaaccgtcaccggtactatgacccgctacag
gggaggtatatcacccaggatccaatagatataaaaggaggatggaatttatattcttat
gcgcttaatccggtaagttggattgacccattaggattgacgcagtgcgattccgaaggg
tgtaataatgatatattatttacaggaggaagtggtcccgataataaaatacttaatgaa
ttaggtccgagagatggcattgacggtttgggttcacaaaacatgaaaatgtatagtggg
ctattagggggcgatattttaaaaccggggattctgggcggtttgacgcttggtagtgtg
acacaacgaccatcgcgaacggctgaggaggaggtgcaagctcaaatagaatatttagca
tataagaagcgttgtgagcaaaaacctgatagtaatttaagtcgttgtgctgccgcgatc
tttcaaaagagcagaaaagaagattgtttaagaatgagacaagaatgggatgataaatgg
tggcctggcaaacatgcggatgaaataaaaaatgtgaaagcatcgttgaaaaacacactt
attgatgttaaaaaaaagatgcatgccaactag

DBGET integrated database retrieval system