KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0415Help
Entry
ECSP_0415         CDS       T00949                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde-CoA dehydrogenase II, NAD-binding
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00360  Phenylalanine metabolism
etw00362  Benzoate degradation
etw00620  Pyruvate metabolism
etw00621  Dioxin degradation
etw00622  Xylene degradation
etw00650  Butanoate metabolism
etw01100  Metabolic pathways
etw01120  Microbial metabolism in diverse environments
etw01220  Degradation of aromatic compounds
Module
etw_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECSP_0415 (mhpF)
   00650 Butanoate metabolism
    ECSP_0415 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ECSP_0415 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECSP_0415 (mhpF)
   00622 Xylene degradation
    ECSP_0415 (mhpF)
   00621 Dioxin degradation
    ECSP_0415 (mhpF)
Enzymes [BR:etw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECSP_0415 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACT70293
Position
436713..437663
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHDQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEEN
VDQLNVNMVTCGGQATIPMVAAVSRVVRVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggcaccgatctgatgatt
aaaattttgcgtcacgatcagcatctggagatggcggtgatggtcggcattgatcctcag
tccgacggtctggcgcgtgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
gggctgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgcggctttgcgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggagaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggtgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcgcga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattatcgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggatat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggttaatttgccg
ggcgtagggcagttctccgggctgaaaacggcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcagaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system