KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0764Help
Entry
ECSP_0764         CDS       T00949                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, membrane subunit, binds cytochrome b556
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00020  Citrate cycle (TCA cycle)
etw00190  Oxidative phosphorylation
etw00650  Butanoate metabolism
etw01100  Metabolic pathways
etw01110  Biosynthesis of secondary metabolites
etw01120  Microbial metabolism in diverse environments
etw01130  Biosynthesis of antibiotics
etw01200  Carbon metabolism
Module
etw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECSP_0764 (sdhD)
   00650 Butanoate metabolism
    ECSP_0764 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECSP_0764 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACT70629
Structure
PDB: 

Position
837069..837416
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgagctgacatatgaagtctggatcggtttctgcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system