KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_2796Help
Entry
ECSP_2796         CDS       T00949                                 

Gene name
galF
Definition
(GenBank) predicted regulatory subunit of UTP--glucose-1-phosphate uridylyltransferase, with GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00040  Pentose and glucuronate interconversions
etw00052  Galactose metabolism
etw00500  Starch and sucrose metabolism
etw00520  Amino sugar and nucleotide sugar metabolism
etw01100  Metabolic pathways
etw01130  Biosynthesis of antibiotics
Module
etw_M00362  Nucleotide sugar biosynthesis, prokaryotes
etw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:etw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECSP_2796 (galF)
   00052 Galactose metabolism
    ECSP_2796 (galF)
   00500 Starch and sucrose metabolism
    ECSP_2796 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ECSP_2796 (galF)
Enzymes [BR:etw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECSP_2796 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ACT72586
Position
complement(2751409..2752302)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcaggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcagtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtacaatctatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggtgaacctttaggtttaggccactccattttatgtgcgcgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctacgctacaaccttgctgccatgattgcgcgcttcaatgaaacgggacgcagc
caggtgctggcaaaacgtatgccgggcgacctctctgaatactccgtcatccagaccaaa
gaaccgctggatcgtgaaggcaaagtcagccgcattgttgaatttatcgaaaagccggat
cagccgcagacgctggactcagacatcatggccgttggtcgatatgtgctttctgccgat
atttggccggaactggaacgtactcagcctggtgcatggggacgtattcagctgactgat
gccattgctgagctggcaaaaaaacaatccgttgatgcaatgctgatgactggcgacagt
tacgactgcggtaaaaaaatgggctatatgcaggcgtttgtgaagtatggactacgcaac
ttgaaagaaggggcgaagttccgcaaaggtatcgagaagctgttaagcgaataa

DBGET integrated database retrieval system