KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_3838
Entry
ECSP_3838         CDS       T00949                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase, Fe-S binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00230  Purine metabolism
etw01100  Metabolic pathways
etw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECSP_3838 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACT73581
Position
3800943..3801422
AA seq 159 aa
MNHSETITIECTINGMPFQLHAVPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
catgccgtaccaggcacgccgctctcggaattactccgcgaacaagggctgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system