KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_4173Help
Entry
ECSP_4173         CDS       T00949                                 

Gene name
kdsC
Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00540  Lipopolysaccharide biosynthesis
etw01100  Metabolic pathways
Module
etw_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:etw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECSP_4173 (kdsC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:etw01005]
    ECSP_4173 (kdsC)
Enzymes [BR:etw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     ECSP_4173 (kdsC)
Lipopolysaccharide biosynthesis proteins [BR:etw01005]
 Unusual sugar
  ECSP_4173 (kdsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 HAD_2 Hydrolase S6PP
Motif
Other DBs
NCBI-ProteinID: ACT73908
Structure
PDB: 

Position
4142434..4143000
Genome map
AA seq 188 aa AA seqDB search
MSKAGASLATCYGPVSADVIAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENV
AYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKL
DEAKGQSI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagcaggtgcgtcgcttgcgacctgttacggccctgtcagcgccgacgttata
gcaaaagcagagaacattcgtctgctaatcctcgacgttgatggcgtactgtcagatggc
ctgatttatatgggcaataacggcgaagagctgaaagcgttcaatgttcgtgacggttat
ggcattcgttgtgcgctcacctctgatattgaagtcgctatcattaccgggcgaaaggct
aaactggtagaagatcgttgtgccacattggggatcactcacttgtatcaggggcagtca
aacaaactgatcgcctttagcgatctgctggaaaaattggcgattgccccggaaaatgtg
gcttatgtcggcgatgatctcatcgattggccggtaatggaaaaagtgggtttaagcgtc
gccgtggccgatgcgcatccactgttgatcccgcgcgccgattacgtgacgcgcattgct
ggcggtcgtggcgcagtgcgagaagtttgcgacttattactcctggcgcagggcaaactg
gatgaagccaaagggcaatcgatatga

DBGET integrated database retrieval system