KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_4938Help
Entry
ECSP_4938         CDS       T00949                                 

Gene name
yihU
Definition
(GenBank) predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain
  KO
K08318  4-hydroxybutyrate dehydrogenase / sulfolactaldehyde 3-reductase [EC:1.1.1.61 1.1.1.373]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00650  Butanoate metabolism
etw01100  Metabolic pathways
etw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ECSP_4938 (yihU)
Enzymes [BR:etw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.61  4-hydroxybutyrate dehydrogenase
     ECSP_4938 (yihU)
    1.1.1.373  sulfolactaldehyde 3-reductase
     ECSP_4938 (yihU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 3HCDH_N UDPG_MGDP_dh_N TrkA_N IlvN 2-Hacid_dh_C Sacchrp_dh_NADP ApbA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACT74637
Position
complement(4928418..4929314)
Genome map
AA seq 298 aa AA seqDB search
MAAIAFIGLGQMGSPMASNLLQQGHQLRVFDVNAEAVRHLVDKGATPAANPAQAAKDAEF
IITMLPNGDLVRSVLFGENGVCESLSTDALVIDMSTIHPLQTDKLIADMQAKGFNMMDVP
VGRTSANAITGTLLLLAGGTAEQVERATPILMAMGSELINAGGPGMGIRVKLINNYMSIA
LNALSAEAAVLCEALNLPFDVAVKVMSGTAAGKGHFTTSWPNKVLSGDLSPAFMIDLAHK
DLGIALDVANQLHVPMPLGAASREVYSQARAAGRGRQDWSAILEQVRVSAGMTAKVKM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaatcgcgtttatcggtttaggacaaatgggttcgccaatggcgagcaattta
ttgcagcaagggcaccaacttcgcgtctttgatgtgaatgccgaggctgtgcggcatctg
gtagacaaaggcgcgactcccgccgccaacccggcgcaggccgctaaagatgccgaattt
atcattaccatgttgccgaatggcgatctggtgcgcagcgtgttgttcggtgaaaacggc
gtttgcgaaagcttatctaccgatgcgctggtcattgatatgtcgaccatccatccgctg
caaaccgataaattgattgccgatatgcaagccaaaggcttcaacatgatggatgttccg
gtaggccgtacttctgcaaatgccattaccggtactctgttactgctggctggcggcacc
gctgaacaagttgaacgtgccacgccgatcctgatggcgatgggcagtgagttgatcaac
gcaggcggtccgggcatggggatccgcgttaagctcatcaacaactatatgagcatcgcg
ctcaatgcgctttcggcagaagctgccgttttgtgcgaagccctgaatcttcccttcgat
gttgccgtcaaagtgatgagcggtaccgccgccggtaaaggccacttcaccacttcctgg
ccgaacaaagtcctcagcggggatctttctcccgccttcatgatcgatcttgcccataag
gatcttggcatcgcccttgatgtcgccaaccagctgcatgtgccaatgccgctgggggcc
gcctcacgggaggtttatagccaggcgcgcgcagcgggtcgcggtcgccaggactggtcc
gccattctggaacaggtccgtgtcagtgccgggatgactgccaaagtaaaaatgtaa

DBGET integrated database retrieval system