KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_4982Help
Entry
ECSP_4982         CDS       T00949                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00010  Glycolysis / Gluconeogenesis
etw00051  Fructose and mannose metabolism
etw00562  Inositol phosphate metabolism
etw01100  Metabolic pathways
etw01110  Biosynthesis of secondary metabolites
etw01120  Microbial metabolism in diverse environments
etw01130  Biosynthesis of antibiotics
etw01200  Carbon metabolism
etw01230  Biosynthesis of amino acids
Module
etw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etw_M00002  Glycolysis, core module involving three-carbon compounds
etw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSP_4982 (tpiA)
   00051 Fructose and mannose metabolism
    ECSP_4982 (tpiA)
   00562 Inositol phosphate metabolism
    ECSP_4982 (tpiA)
Enzymes [BR:etw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECSP_4982 (tpiA)
Exosome [BR:etw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECSP_4982 (tpiA)
  Exosomal proteins of bladder cancer cells
   ECSP_4982 (tpiA)
  Exosomal proteins of melanoma cells
   ECSP_4982 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACT74680
Structure
PDB: 

Position
complement(4969872..4970639)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgtgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggtcactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcattcgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcgtctctgaaagctgac
gctttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system