KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_5095Help
Entry
ECSP_5095         CDS       T00949                                 

Definition
(GenBank) putative sorbose PTS component
  KO
K02812  PTS system, sorbose-specific IIA component [EC:2.7.1.206]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00051  Fructose and mannose metabolism
etw01100  Metabolic pathways
etw02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:etw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECSP_5095
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECSP_5095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etw02000]
    ECSP_5095
Enzymes [BR:etw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     ECSP_5095
Transporters [BR:etw02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    ECSP_5095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man STb_secrete HTH_DeoR
Motif
Other DBs
NCBI-ProteinID: ACT74780
Position
complement(5101572..5101979)
Genome map
AA seq 135 aa AA seqDB search
MVNAIFCAHGKLACAMLESVQMVYGNANVEAVEFVPGENAGDIVAKLEKLVSIHNQNEWL
IAVDLQCGSPWNAAAMLAMRNPRLRVISGLSLPLALELVDNQDSMNVDELCEHLTQIAKQ
TCVVWKQLATTEEDF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgccattttttgtgcccacggcaaattagcttgcgccatgctggaatcggtt
cagatggtttacggcaacgccaatgttgaagccgttgaatttgtgcccggtgaaaacgcc
ggagacatcgtagcaaagctggaaaaattagtaagcattcacaatcaaaatgagtggctg
attgccgtggatttacagtgcggcagcccgtggaatgcggcagcgatgcttgcgatgcgc
aatcctcgtctgcgggtaatcagcggactttctctgccgctggcgctcgaactggttgat
aaccaggacagcatgaatgttgatgaactgtgtgaacacctgacgcaaatcgcaaagcaa
acctgcgttgtctggaaacaactggcaacgacagaggaggatttctga

DBGET integrated database retrieval system