KEGG   Faecalitalea cylindroides: EC1_06630
Entry
EC1_06630         CDS       T02586                                 

Definition
(GenBank) hypothetical protein
Organism
euc  Faecalitalea cylindroides
SSDB
Motif
Pfam: DpnD-PcfM
Other DBs
NCBI-ProteinID: CBK88279
UniProt: D4JDK7
Position
complement(632475..632666)
AA seq 63 aa
MNHYDVTIRETLEVKMKVAANSREEAEQFARDQWKRGEVVLDASHFTGVEFHAKRYFRDR
GER
NT seq 192 nt   +upstreamnt  +downstreamnt
atgaaccattatgatgttaccatccgggaaacgctggaggtgaaaatgaaggtggcggca
aacagccgggaggaggccgagcagtttgccagggaccaatggaaacgcggcgaagtcgtt
ctggacgccagccattttaccggcgtggagttccatgccaagcggtatttccgtgaccgg
ggcgagcgatga

DBGET integrated database retrieval system