KEGG   Faecalitalea cylindroides: EC1_11810Help
Entry
EC1_11810         CDS       T02586                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
euc  Faecalitalea cylindroides
Pathway
euc00071  Fatty acid degradation
euc00280  Valine, leucine and isoleucine degradation
euc00310  Lysine degradation
euc00362  Benzoate degradation
euc00380  Tryptophan metabolism
euc00620  Pyruvate metabolism
euc00630  Glyoxylate and dicarboxylate metabolism
euc00640  Propanoate metabolism
euc00650  Butanoate metabolism
euc00900  Terpenoid backbone biosynthesis
euc01100  Metabolic pathways
euc01110  Biosynthesis of secondary metabolites
euc01120  Microbial metabolism in diverse environments
euc01130  Biosynthesis of antibiotics
euc01200  Carbon metabolism
euc01212  Fatty acid metabolism
euc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:euc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EC1_11810
   00630 Glyoxylate and dicarboxylate metabolism
    EC1_11810
   00640 Propanoate metabolism
    EC1_11810
   00650 Butanoate metabolism
    EC1_11810
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EC1_11810
   00072 Synthesis and degradation of ketone bodies
    EC1_11810
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EC1_11810
   00310 Lysine degradation
    EC1_11810
   00380 Tryptophan metabolism
    EC1_11810
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EC1_11810
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EC1_11810
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EC1_11810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:euc04147]
    EC1_11810
Enzymes [BR:euc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EC1_11810
Exosome [BR:euc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EC1_11810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBK88667
UniProt: D4JEP5
Position
complement(1095171..1096376)
Genome map
AA seq 401 aa AA seqDB search
MRKAYIVAAKRSAIGTFMGSLTDVDVADMGATVLKETIKQANIDPANLDEVIIGNVIAAG
LGQNIARNVAFKAGIPVEVCAQSINMLCGSGLKAVMEATLRIQANFGDLYVAGGVESMTR
APFLLSYKNRKGVKSGDMTVVDSMLHDGLTDAMYGIHMGVTADNIAKKYNISREAQDEFA
LASQQKALAAIESGRFKDEIVPITYSTRKGEVVFDTDEHPRQTSMEKLAKLRPAFTKDGT
VTAGNASGINDGASFTIIASEDAVKKYNLKPICEVVGFGQGGVDPRVMGLGPTPAILNAL
KYADLKIEDMELVELNEAFAAQSLGVIHELEEATGMDREEFLKKTNVNGGAIALGHPVGA
SGNRILVTLIHEMQKRNLTTGLASLCIGGGQGAAVIIKMCK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcttatatcgtcgctgcaaaacgtagcgcaattggtacctttatgggcagc
ttgacagacgttgatgttgccgatatgggagcaactgtattaaaagaaacaatcaaacag
gccaacattgatcctgcaaaccttgatgaagttatcatcggtaatgtaattgctgcagga
cttggacaaaacatcgcccgtaacgtcgcttttaaagcaggtattcctgtagaagtatgt
gctcaatccattaacatgctttgtggttctggtttaaaagctgtaatggaagcaacttta
agaattcaggcaaactttggtgatctttatgtagctggtggtgttgaatcaatgacacgc
gctccattcttattgagctataagaatcgtaaaggtgttaaatctggtgatatgacggtc
gtagactctatgttgcatgatggtttaacagatgctatgtatggaattcacatgggtgta
acagccgataatattgccaaaaagtataacatctctcgtgaagcacaggatgaatttgct
ttagcaagtcagcaaaaagctttggcagctattgaatctggtcgcttcaaagatgaaatc
gttcctatcacttattccacaagaaaaggtgaagtagtttttgatacagatgaacatcct
cgtcaaacaagcatggaaaaactagctaaacttcgtccagctttcacaaaagacggaacc
gttacagcaggtaatgcttcaggtatcaatgatggtgcttctttcacgatcatcgcaagt
gaagacgccgttaagaaatataacttaaaaccgatctgtgaagttgtgggatttggtcaa
ggtggtgttgatccacgtgtcatgggacttggccctactcctgctatcttgaacgcattg
aaatatgcagatcttaagattgaagatatggaattggttgaattaaatgaagcgtttgct
gcacaatctcttggtgttattcatgaacttgaagaagctactggtatggatcgtgaagaa
ttcttgaaaaagacaaacgtaaatggtggtgcaattgcattaggacacccagttggtgct
tctggtaaccgtatccttgttactttgatccacgaaatgcaaaaacgtaatttaactaca
ggtcttgcatctctatgtatcggtggaggtcaaggagcagctgttattatcaaaatgtgc
aaataa

DBGET integrated database retrieval system