KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0215Help
Entry
ECUMN_0215        CDS       T00831                                 

Definition
(RefSeq) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    ECUMN_0215
Secretion system [BR:eum02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECUMN_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL ImpA_N
Motif
Other DBs
NCBI-GeneID: 7154618
NCBI-ProteinID: YP_002410986
UniProt: B7N880
Position
complement(242027..243385)
Genome map
AA seq 452 aa AA seqDB search
MSNYALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLVESLALSIFKANGVDL
HTATYYTLARTRNQGLAGFCEGSELLAAMITHEWDKFWPQGGPARTEMLDWFNTRTGNIL
RQQVSFSENDLPLLYRTERALQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPGNR
TDTAAQTTVRTLVYAPESTASTTAEAVPPLPDLPEMRVEVRGVANNADNVRQGSTVKGFV
AGAACTAVIAAVLWWWQAYPIQRQLTQVRDTAQGAATAWLASPVLKEYEQYLQQLLDAPP
LQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFAD
LMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLTQYQETRARKQDTQALEKEINE
RLDGLLSRWLLLKNTGQDMATDTRTEPVHPTH
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattacgcactgacacaaactatcgttaccggcagcgatccgcgcgccctgccg
gagttcagcgccatccgcgaagaaattaacaaagctaaccacccgtcacagccggagctg
aactggaaactggtggaatcgctggcgctgtcgatttttaaggccaacggggtggatttg
cataccgccacctactatacgctggcgcgtacccgtaatcaggggctggcagggttctgc
gaaggctcggaactgctggctgcgatgatcacccacgaatgggataaattctggccgcag
ggtggcccggcgcggactgagatgctggactggttcaatacccgcaccgggaatattctg
cgccagcaggtgtccttttccgaaaatgatctgccgttgctctaccgcacggaacgggct
ttacagcttatttgcgacaaactccagcaggtggaactgaagcgccagccgcgcgtggaa
aacctgctttattttgtgcagaacacacgcaagcggtttgagccgcagcccggaaaccgt
actgatacggcggcacagaccacggtccggacgctggtctatgcgccggaaagcacggct
tccaccacagcggaagccgtgcctcccctgcccgacctgccggaaatgcgggtggaggtg
cgcggtgtggcaaataacgccgacaacgttagacagggcagcacggtaaaaggttttgtt
gccggtgccgcctgtactgccgttatcgcggcagtactctggtggtggcaggcgtatccg
atacaacggcagcttacgcaagtcagggataccgcacagggagccgccaccgcctggttg
gcctccccggtactgaaagaatatgaacagtacctgcaacagcttctggatgccccgcca
ctacagccgctggaaaccggaatgcagatgatgcgcaccgcagacaccctctggccggaa
agcctgcaacagcaggaagccagcaggatgtggagcaacacgctgagaaaccgggcgcaa
gccagtccgcagatgaagggctggcaacaggcgcggcagaatttgcgggactttgcggat
ctgatgatgaaaaaggagacggagaaacagggtttcaccctctcgtatatcaagacggtg
acctggcaggccgaacggttactgaatcaggaaacaccgctggagtacctgctgacacag
taccaggagacacgcgcacggaagcaggacacacaggcgctggaaaaagagatcaacgaa
cggctggacgggctgttaagccgctggctactgctgaaaaataccggacaggatatggca
acggataccagaaccgaacctgtccatccgactcattga

DBGET integrated database retrieval system