KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0217
Entry
ECUMN_0217        CDS       T00831                                 

Definition
(RefSeq) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    ECUMN_0217
Secretion system [BR:eum02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECUMN_0217
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N FAM86
Other DBs
NCBI-GeneID: 7154620
NCBI-ProteinID: YP_002410988
UniProt: B7N882
Position
complement(246943..248451)
AA seq 502 aa
MTGWHGLLRRYATPATGRENKNMAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFV
DSEIVKLGSLAHSQLDIPELQRRGLMLLASETKDFRLLAHLLRTLQHAGDILLASRMLAQ
YTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATIQRDALLGELAKLAQCWQA
HNAPELAKATDDLFALFQRAFRDVAPEMPSSARTAAIAPQATAGSVPDMSPHTVAAQPPV
AATPIPQVTVDSHDDKAWRDTLLKVAAILCERQPESPQGYRLRRHALWQTITSTPQAESD
GRTPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQTALRLGYKQV
ADAIRDEVTGFLARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTAPVVQTDEELQAA
RACFDENGLEAALRYLENLPEGDPRHQFHRQFFGAQLLEEAGMVQLAQQQYRILFRTGLH
MMLSEWEPSLLEALEQKFTAEQ
NT seq 1509 nt   +upstreamnt  +downstreamnt
ttgacgggctggcacgggttattgcgccgctacgcgacgcctgccactgggcgggagaat
aagaatatggcaatggacttacgtaatcccgatgtatggcttgcacacctgctggaaaac
ctgccggaagataagctgtccgccgcgcttgatgatggcaatgcagactgggagtttgtc
gacagcgaaatcgtcaagctcggttcactggcgcacagccagcttgatatcccggaactt
cagcgccggggcctgatgcttctggcctcagaaaccaaagattttcgcctgctggcccac
ctgctgcgtaccctgcaacatgccggtgatattctgctggcctccaggatgctggcacaa
tatacagaacactactggacatgcgccgcaccgcagaacatggcccacaaaaaacgcttt
gccgcccaggtgataaaacgctttgagtctgccgttcaggactttgccgggaatgctgcg
acaatacagcgcgatgctttgctgggagagctggcaaaactggcacagtgctggcaggcg
cacaacgctcctgagctggctaaggcgacagacgatttatttgccctgtttcagcgcgcg
tttcgtgatgtagcgcctgaaatgccatcatctgcacgaaccgccgccattgcgccgcag
gccacagccggatctgtaccggatatgtcaccgcacacggttgccgctcagcctcctgtt
gcagccactccaatcccgcaggtcactgttgacagccacgacgataaagcatggcgcgac
accctgctgaaggtggccgccattctctgtgagcgccagccggagtcaccgcagggttac
cgactgcgccgccatgctctgtggcagaccatcaccagtaccccgcaggcagaaagcgat
ggccggaccccactggcagccttccctgtcgatatgatggatgattacctggcgcggctg
aacaatgccgacatggcgctgtggcagcaggtggaaaaaagcctgctgctggccccgtac
tggctggacggtcattacctctcagcacagaccgcgctgcgcctcggttataaacaggtg
gcggatgctatccgtgatgaagttaccggttttctggcccgcctgcccgcactgatcaac
ctgttgtttaacgaccgcactccgtttgtgtccgaacagacgaaacagtggctggcatca
tccggctcagtcaaccagaccgccccggttgtacagaccgatgaagaattacaggcggcc
agggcgtgcttcgatgaaaacgggctggaagccgcgctgcggtacctggaaaacctgccc
gaaggtgatccccgccaccagtttcaccgccagtttttcggcgcgcagttactggaagag
gccggtatggttcagcttgcacaacagcagtaccggatactcttcagaacaggattacac
atgatgctgtccgaatgggaaccgtccctgctggaagcactggaacaaaaattcacggca
gaacagtaa

DBGET integrated database retrieval system