KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0220
Entry
ECUMN_0220        CDS       T00831                                 

Definition
(RefSeq) Putative membrane protein Aec26
  KO
K11892  type VI secretion system protein ImpK
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eum00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECUMN_0220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    ECUMN_0220
Secretion system [BR:eum02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECUMN_0220
SSDB
Motif
Pfam: DotU DUF2721
Other DBs
NCBI-GeneID: 7154623
NCBI-ProteinID: YP_002410991
UniProt: B7N885
Position
complement(251872..252645)
AA seq 257 aa
MSDISDMGEPSVFPMEPESGTSGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAM
PEHLFAQVVTDVQAVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSL
LVHFHNEAWGGEKVFILLERLIREPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERI
YQRLHHALHKLRGDAPFPLLHQKNNIQGGRYQLIRRLTIRHVLCGGLVVLAVFYLFYLLR
LDSQTQDILHQLNKLLR
NT seq 774 nt   +upstreamnt  +downstreamnt
atgagcgatatcagcgatatgggtgaaccgtcggtttttcccatggagccggagagcgga
acatcaggacgtcagtaccgtctcgcccttcgcggcaacagcctgaacccaatgattgac
gccgccacgccgttgctcggcatggtgatgcgtctgtccaccatgaacagccaggccatg
ccggaacatctgtttgcccaggtggtaaccgatgtccaggctgtggaacaactactccag
gagcagggttacgagccgggcgtcattgtttcgttccgctacattctctgcacgtttatt
gacgaagcggcgctgggcaacggctggtccaacaaaaacgaatggataaaacagtcgcta
ctggttcatttccataacgaagcctggggcggcgagaaagtgtttatcctgctcgaacgc
ctgatccgggagccggtacgttaccaggatctgctggaatttttatacctctgcttttcg
ctgggctttcgcgggcgctacaaggttgccattcagcaacaggatgaatttgagcggatc
taccagcgcctgcaccatgccctgcacaaactgcgcggtgacgcgccatttccgctgctt
caccagaagaacaacatacagggcgggcgttatcagttaatccggcggctgaccatcagg
catgtactgtgcggcggtcttgttgtgctggccgtattttatctgttttatctgctgcgt
ctggacagccagacacaggatattctgcatcagctcaataaattactccgataa

DBGET integrated database retrieval system